KEGG   Arthrobacter aurescens: AAur_0888Help
Entry
AAur_0888         CDS       T00447                                 

Gene name
tmk
Definition
thymidylate kinase (EC:2.7.4.9)
Orthology
K00943  
dTMP kinase [EC:2.7.4.9]
Organism
aau  Arthrobacter aurescens
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AAur_0888 (tmk)
Enzymes [BR:aau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     AAur_0888 (tmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(934479..935168)
Genome map
AA seq 229 aa AA seqDB search
MSIKSPGLFIAFEGGDGAGKSTQAARLSDALESQGLSVLRTREPGGTPIGEKLRSLVLDH
GNGTIDPRTEALMFAAARAAHASQVIRPALAGGTVVITDRYIDSSVAYQGAGRGLGAEGV
LSLNEWATEGLHPDLTVLLDVDPSDGRQRRTAGDATEDRLESEPDHFHSAIRHAFLDLAA
AAPSSYLVLAASADIETLAAQILERVETLLGDRISGETAAGEAVSGDRP
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgagtattaagagtccaggccttttcatcgccttcgaaggcggggacggagcgggcaag
tccacccaggccgcccggctctccgacgccctcgagtcacagggcctttccgtgctgcgc
acccgcgaaccaggcggcacccccatcggcgagaaattgcgctccttggtcctggaccac
ggaaacggcaccatcgatccccgcacggaagccctcatgttcgccgctgcccgcgcagcc
catgccagccaagtgatccggcccgcgctggctggcggaacagtggtcatcaccgaccgc
tacatcgattcatccgtcgcctatcagggtgccggccgcggcctcggcgccgaaggcgtt
ttgtcactcaatgagtgggccaccgaaggcctgcatccggacctgacggtactgctcgac
gtcgacccctccgacggccgccaacgccggaccgccggggacgccaccgaggacaggctg
gagtccgagcctgaccacttccattccgccatccgccacgcattcctggacctcgcggcg
gctgcaccgtccagctatctggtgctggctgccagtgccgacattgaaacattggcagca
cagatcctggaacgagtggagacgttgttgggtgaccggatttcgggcgaaaccgctgcg
ggcgaagccgtttcgggcgaccgcccgtga

DBGET integrated database retrieval system