KEGG   Arthrobacter aurescens: AAur_0892Help
Entry
AAur_0892         CDS       T00447                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aau  Arthrobacter aurescens
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AAur_0892 (gpmA)
   01230 Biosynthesis of amino acids
    AAur_0892 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_0892 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    AAur_0892 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AAur_0892 (gpmA)
Enzymes [BR:aau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AAur_0892 (gpmA)
Exosome [BR:aau04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AAur_0892 (gpmA)
  Exosomal proteins of melanoma cells
   AAur_0892 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
937713..938468
Genome map
AA seq 251 aa AA seqDB search
MKTMTYKLILLRHGHSEWNAKNLFTGWVDVDLNDQGREEAVRGGELLVENEILPDVLYTS
LLKRAINTANMALDKADRGWIPVKRDWRLNERHYGALQGKDKAQTLAEFGEEQFMEWRRS
YDTPPPPLSDDSEFSQAHDVRYKDLGDALPRTECLKDVLVRLLPYWESDIKEDLKAGKTV
LVTAHGNSLRALVKHLDGISDDAIAGLNIPTGIPLVYELDEDFQPINPGGTYLDPDAAAQ
AILAVANQGKK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatgacttacaagctgattctgctgcgccatggccacagcgaatggaacgcc
aagaacctgttcaccggttgggtggacgttgacctgaacgatcaaggccgcgaagaagca
gtgcgcggtggagagctcctggttgagaacgagatcctcccggacgtcctctacacctcg
ctcctgaagcgtgccatcaacacggccaacatggccttggacaaggccgaccgcgggtgg
atccccgtcaagcgcgactggcgcctgaacgagcgccactacggcgccctgcagggcaag
gacaaggcccagacccttgccgaattcggcgaagagcagttcatggaatggcgccgcagc
tacgacaccccgccgccgcccctgtcggacgacagcgaattctcgcaggcacacgacgtc
cgctacaaggacctcggcgacgcactgccgcgcaccgaatgcctcaaggacgttctggtc
cgcctgctcccttactgggaatcggacatcaaggaagacctcaaggccggcaagaccgtt
ctggttaccgcccatggcaactccctgcgcgccctggtgaagcacctggatggcatcagc
gatgacgccattgccgggctgaacatccccacgggcatcccgctggtctacgaactggat
gaggacttccagcccatcaacccgggcggaacctacctggatcccgacgcagcagcccag
gccatcctcgcggtggccaaccagggcaagaaatga

DBGET integrated database retrieval system