KEGG   Arthrobacter aurescens: AAur_1109Help
Entry
AAur_1109         CDS       T00447                                 

Definition
(RefSeq) triosephosphate isomerase (tpiA)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aau  Arthrobacter aurescens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AAur_1109
   01230 Biosynthesis of amino acids
    AAur_1109
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_1109
   00051 Fructose and mannose metabolism
    AAur_1109
   00562 Inositol phosphate metabolism
    AAur_1109
Enzymes [BR:aau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AAur_1109
Exosome [BR:aau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AAur_1109
  Exosomal proteins of bladder cancer cells
   AAur_1109
  Exosomal proteins of melanoma cells
   AAur_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1178972..1179772
Genome map
AA seq 266 aa AA seqDB search
MMLPAPDTVFIGVSTKMYMGYAHSLEWVEQLVAEVDARPALTAGRVVPFVIPSFPVLPEA
ARLLAGTPLVLGAQNCSWADGPWTGEVSPSMLAELGVGLVEIGHAERRRYFGEDEAMIAL
KVSAAVDAGLTPLLCVGETEVLEPEAAAAMVFLHIKAAVSGDWSVASQLVIAYEPVWAIG
APEPASAEYVSRVVAALRESLAQHGLAGIPVIYGGSAKPGLLPQLDGVSGLFLGRFAHDA
ANFGRVLDEALSFCTADALKTPSRGR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgatgctgcctgctcctgacaccgtgttcattggtgtcagcaccaagatgtacatgggc
tacgcgcatagcctggaatgggtggaacagctggtggctgaagtggacgcccgtccggcc
ctcacggccgggcgggtggtcccgtttgtgatcccgtcgtttccggtattacccgaggca
gcgcggctccttgccggaacgccgctggtcctgggtgcgcagaattgcagctgggccgac
gggccgtggacgggcgaggtgtcaccctccatgcttgctgagctcggcgttggactcgtg
gagatcggccacgcagaacgacgccgctacttcggtgaagatgaggcgatgattgcgctc
aaggtgagtgccgccgtcgacgccggactgacgccgctgctgtgcgtgggggagaccgaa
gtcctcgaaccggaggcggctgcagccatggtgtttttgcacatcaaggcagccgtttcg
ggcgactggtcggtcgcctcccaactggtgattgcgtatgaacctgtgtgggcgatcggt
gctcctgagcctgcctcggccgagtatgtttcccgcgtggtggctgccctgcgcgaatcg
ttggcccagcacggattggccgggattcctgtcatctacggaggctccgccaaacctgga
ctgttgccgcagctggacggggtgtccgggcttttcctcggccggtttgcccacgacgcc
gccaacttcggacgggtcctcgacgaagccctgagtttttgtacagcagatgcccttaag
acgccttctagagggcgttag

DBGET integrated database retrieval system