KEGG   Paenarthrobacter aurescens: AAur_1109Help
Entry
AAur_1109         CDS       T00447                                 

Definition
(GenBank) putative triosephosphate isomerase (tpiA)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00010  Glycolysis / Gluconeogenesis
aau00051  Fructose and mannose metabolism
aau00562  Inositol phosphate metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01200  Carbon metabolism
aau01230  Biosynthesis of amino acids
Module
aau_M00002  Glycolysis, core module involving three-carbon compounds
aau_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_1109
   00051 Fructose and mannose metabolism
    AAur_1109
   00562 Inositol phosphate metabolism
    AAur_1109
Enzymes [BR:aau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AAur_1109
Exosome [BR:aau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AAur_1109
  Exosomal proteins of bladder cancer cells
   AAur_1109
  Exosomal proteins of melanoma cells
   AAur_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABM06931
UniProt: A1R3T4
Position
1178972..1179772
Genome map
AA seq 266 aa AA seqDB search
MMLPAPDTVFIGVSTKMYMGYAHSLEWVEQLVAEVDARPALTAGRVVPFVIPSFPVLPEA
ARLLAGTPLVLGAQNCSWADGPWTGEVSPSMLAELGVGLVEIGHAERRRYFGEDEAMIAL
KVSAAVDAGLTPLLCVGETEVLEPEAAAAMVFLHIKAAVSGDWSVASQLVIAYEPVWAIG
APEPASAEYVSRVVAALRESLAQHGLAGIPVIYGGSAKPGLLPQLDGVSGLFLGRFAHDA
ANFGRVLDEALSFCTADALKTPSRGR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgatgctgcctgctcctgacaccgtgttcattggtgtcagcaccaagatgtacatgggc
tacgcgcatagcctggaatgggtggaacagctggtggctgaagtggacgcccgtccggcc
ctcacggccgggcgggtggtcccgtttgtgatcccgtcgtttccggtattacccgaggca
gcgcggctccttgccggaacgccgctggtcctgggtgcgcagaattgcagctgggccgac
gggccgtggacgggcgaggtgtcaccctccatgcttgctgagctcggcgttggactcgtg
gagatcggccacgcagaacgacgccgctacttcggtgaagatgaggcgatgattgcgctc
aaggtgagtgccgccgtcgacgccggactgacgccgctgctgtgcgtgggggagaccgaa
gtcctcgaaccggaggcggctgcagccatggtgtttttgcacatcaaggcagccgtttcg
ggcgactggtcggtcgcctcccaactggtgattgcgtatgaacctgtgtgggcgatcggt
gctcctgagcctgcctcggccgagtatgtttcccgcgtggtggctgccctgcgcgaatcg
ttggcccagcacggattggccgggattcctgtcatctacggaggctccgccaaacctgga
ctgttgccgcagctggacggggtgtccgggcttttcctcggccggtttgcccacgacgcc
gccaacttcggacgggtcctcgacgaagccctgagtttttgtacagcagatgcccttaag
acgccttctagagggcgttag

DBGET integrated database retrieval system