KEGG   Paenarthrobacter aurescens: AAur_1148Help
Entry
AAur_1148         CDS       T00447                                 

Definition
(GenBank) putative oxidoreductase, zinc-binding dehydrogenase family
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00010  Glycolysis / Gluconeogenesis
aau00071  Fatty acid degradation
aau00350  Tyrosine metabolism
aau00625  Chloroalkane and chloroalkene degradation
aau00626  Naphthalene degradation
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_1148
  Lipid metabolism
   00071 Fatty acid degradation
    AAur_1148
  Amino acid metabolism
   00350 Tyrosine metabolism
    AAur_1148
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AAur_1148
   00626 Naphthalene degradation
    AAur_1148
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AAur_1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N YjeF_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABM08071
UniProt: A1R3X4
Position
1222259..1223254
Genome map
AA seq 331 aa AA seqDB search
MKAFVLTQYKQPLQQIDVPEPVLGDHDVLVQVKAAGLNQLDEKIRLGEFKQVLPYKLPQV
LGHDVAGTVVQIGEKVRSFKPGDEVFARPGNDSIGTFAERVAVAEEDLAIKPATISMEEA
GSLPLVALTAWQALVERGSVGPGQKVLIHAGAGGVGSIAIQLAKYLGATVATTVSAGNRG
FVRELGADVVIDYRTEDFTEILHDYDLVLDSLGGENLERSLKVLKKGGRAIGIAGPPDAG
LARQLGGNPVLLGLMTLLSSRIRRQARQLGVTYEFLFMQANGKQLREIAALIDAGDIKPI
VGRVIPFDQTSDVLAALDKGGVRGKTVVSHL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcgtcctcacccaatacaagcaaccgttgcagcagatcgacgtcccggag
cccgtgctcggggatcatgacgtactggtccaagtgaaagccgccggactgaaccagctc
gacgagaagatcaggctgggggagttcaagcaggtcctcccctacaagctgccgcaggtt
cttggtcatgatgtggccggtaccgttgtgcagatcggggagaaggtgcggtccttcaaa
cccggcgacgaggtgtttgcacgccccggaaatgacagcatcgggacgttcgcggagcga
gtcgctgtcgccgaggaagacctggccatcaagccggcaaccatcagtatggaagaggcc
ggctcgcttccgctggtggcgctgaccgcgtggcaggcacttgttgagcggggctccgtg
ggcccgggccagaaagtactcatccacgcgggcgccgggggagtgggctccatcgctatc
cagctcgctaagtacctcggggccacggtagctactacggtcagtgccgggaacaggggc
tttgttcgggaactcggagcggatgtggtgatcgactaccggaccgaggacttcaccgag
atccttcacgactacgacctggtccttgacagcctcgggggcgagaacctggagcgctcc
ttgaaggtcctgaagaagggtggccgggccattggcatcgcagggccgccggatgccggc
ttggcacgccagctgggcggaaacccagttctgctcgggttgatgaccctgctcagctcg
cggatccgccgccaagcccgccagttgggagtcacgtacgagttcctcttcatgcaggcc
aacggcaagcagttgcgcgagatcgcagcactcatcgacgccggagacatcaagccaata
gtgggacgggtcattccgttcgatcagacctccgacgttctggcagcccttgataagggc
ggcgtccgcggcaagaccgttgttagccatctctaa

DBGET integrated database retrieval system