KEGG   Arthrobacter aurescens: AAur_1246Help
Entry
AAur_1246         CDS       T00447                                 

Definition
succinate dehydrogenase, membrane subunit (sdhD)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
aau  Arthrobacter aurescens
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AAur_1246
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AAur_1246
   00650 Butanoate metabolism
    AAur_1246
  Energy metabolism
   00190 Oxidative phosphorylation
    AAur_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1330822..1331298)
Genome map
AA seq 158 aa AA seqDB search
MTTIETPRSGKIGSGKIAPKYNRTGSSRGNFEMIAWLFMRLSGIVLVVLIFGHLFVNLLV
GEGIHAIDFGFVAGKWADPFWQFWDLAMLWLAMLHGTNGVRTIINDYAEKDSTRFWLKMV
LYAATLVIIILGTLVIFTFNPCPVVDGVQLPGGFCPAP
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccatcgagacaccacgcagtggaaaaatcgggtccgggaagatcgcaccgaag
tacaaccgcaccggctccagccgtggcaacttcgagatgatcgcctggctcttcatgcgt
ctctccggcatcgtcctggtggtgctgatcttcggccacctgttcgtcaacctgctggtg
ggcgagggcatccacgcaatcgacttcggcttcgttgccggcaagtgggccgatccgttc
tggcagttctgggaccttgccatgctgtggcttgccatgcttcacggcaccaacggcgtc
cgcaccatcatcaacgactacgccgagaaggattccacgcgcttctggctcaagatggtc
ctctacgcggccaccctggtcatcatcatccttggcacactggtgatcttcaccttcaac
ccgtgccccgtcgtcgacggcgttcagttgcctggtggtttctgcccggccccgtag

DBGET integrated database retrieval system