KEGG   Arthrobacter aurescens: AAur_1258Help
Entry
AAur_1258         CDS       T00447                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
aau  Arthrobacter aurescens
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aau00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1342459..1343769
Genome map
AA seq 436 aa AA seqDB search
MTSTEAFDAVQIISIKRDKGTLTPEQIDWTIDAYTRGVIAEEQMAALNMAILLNGMDRAE
ISQWTSAMIASGERMDFSSLTRPDGGRKATSDKHSTGGVGDKITLPLAPLVAVFGVAVPQ
LSGRGLGHTGGTLDKLEAIPGWRANLSNDEIMAQLQDVGAVICAAGSGLAPADKKLYALR
DVTGTVEAIPLIASSIMSKKIAEGTGSLVLDVKVGSGAFMKDEARARELAETMVALGKDA
GVHTVALITDMSTPLGLTAGNAIEVEESVEVLAGGGPEDVVELTVRLAEEMLAGAGIHDA
DPAAALKDGRAMDVWNRMIEAQGGDPRAALPVARESEVVYAPADGVLVGLDALSVGVAAW
RLGAGRARKEDQVQAGAGVRLHAKPGALVRAGEPLMTLLTDTPEKFERAKEALQDAVVIA
PEGSRPAHQLIIDRIA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgacaagcactgaagcgttcgacgccgtccagatcatttccatcaagcgggacaagggc
acgcttactcccgagcaaatcgactggaccatcgatgcctatacccgcggcgtcatcgcc
gaggaacagatggccgcactgaacatggccatcctgctcaacggcatggaccgcgccgag
atttcgcagtggacgtccgcaatgatcgcctctggtgagcggatggacttttcgtccctg
acaaggcccgacggcggccggaaggctaccagcgacaagcactccaccggtggggtgggg
gataagatcacgctgccgttggcgccgctggtggctgtgttcggcgtcgcggttccgcag
ctgtcgggccgcggcctcggccacaccggcgggacgctggacaagctggaggccatcccc
gggtggcgcgccaacctgagcaacgacgaaatcatggcccagctccaggacgtcggcgca
gtcatctgtgccgcaggctcagggctcgccccggcggacaagaaactctatgccttgcgc
gacgtgacaggcaccgttgaagccatcccgctgattgcttcgtcgatcatgagcaagaag
atcgccgaaggtaccggttcgctggttttggacgtcaaagtgggttcgggcgcgttcatg
aaggacgaagcacgggcacgtgagctggctgagaccatggtggctttgggcaaggatgca
ggcgtacacaccgtcgcgctgatcacggacatgtccacgccgcttggattgactgccggt
aacgccattgaggtggaggaatcagtggaggtccttgccggcggcggtccggaagacgtg
gtcgaactgaccgtccgcctggccgaggagatgctggccggtgccggcatccacgacgcc
gatcccgcagccgcgctgaaggacggacgcgccatggacgtctggaaccggatgatcgaa
gcccaaggtggagatccccgggccgcgctgcccgtggccagggaatccgaggttgtctac
gctccggcggacggcgtcctggtgggattggacgcactttccgtgggtgttgcggcttgg
cgcctgggtgccggccgggcacgcaaggaagaccaggtccaggccggggcgggtgtccga
ttacacgccaagcctggtgcgctggtccgtgcgggggagcctttgatgaccctcctgacg
gacactccggagaagttcgaacgggcaaaggaagcacttcaggatgcggtggtgattgcg
cctgagggttcccgcccggcgcatcagctcatcatcgaccgcatcgcctag

DBGET integrated database retrieval system