KEGG   Paenarthrobacter aurescens: AAur_1375Help
Entry
AAur_1375         CDS       T00447                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00010  Glycolysis / Gluconeogenesis
aau00620  Pyruvate metabolism
aau00640  Propanoate metabolism
aau00680  Methane metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_1375 (acsA)
   00620 Pyruvate metabolism
    AAur_1375 (acsA)
   00640 Propanoate metabolism
    AAur_1375 (acsA)
  Energy metabolism
   00680 Methane metabolism
    AAur_1375 (acsA)
Enzymes [BR:aau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AAur_1375 (acsA)
Lipid biosynthesis proteins [BR:aau01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AAur_1375 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABM06841
UniProt: A1R4J1
Position
complement(1476558..1478570)
Genome map
AA seq 670 aa AA seqDB search
MTIQPATQSDALANLLREDRSFAPDAGFAANAVADASRYGAAAADRLGYWASRAREVLTW
EKDFTQVLDWSEAPVARWFADGTLNAAYNALDRHVENGLGDRVAIHFEGEPGDTRSYTYA
QLTEEVKKAANAFESLGVAKGDRVAVYLPMIPEAVITMLACARIGAIHSVVFGGFSAEAL
RSRIDDAEAKLVVTADGTFRRGKPSPLKPAVDQALAESGHTVQNVIVVKRNHQDVAWTPG
LDRWWHETVSTASAEHTAVAHEAEHPLFILYTSGTTGKPKGILHTTGGYLVQGAATHKDT
FDLHPETDVYWCTADVGWVTGHSYVTYAPLVNGATQVIYEGTPDCPHQGRWWEIVEKYGV
TILYTAPTAIRTFMKWGRQIPDSHDLSSLRVLGSVGESINPEAWMWYREVIGSNNGPGTD
GAPGPRKEHPAPIVDTWWQTETGAHMIAPLPGVTATKPGSAQVPVPGIGVDVVDEMGAPV
PNGQGGFLVIREPWPAMLRGIWGDMDRYQDTYWSRFEHMYFAGDGAKRDEDGDIWLLGRV
DDVMNVSGHRLSTTEIESALVSHPLVAEAAVVGAKDETTGEAVVAFVILRTTPGEGEDVE
QVLRAHVAKEIGPIAKPRHILAVPELPKTRSGKIMRRLLKDVAEGRDPGDATTLADPTVM
AQIAADLRKG
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
ttgactattcaacccgctacccagagcgatgcgcttgccaatctgctgcgcgaggaccgc
agcttcgccccggacgcgggcttcgccgcgaacgcggtggcggacgcgtcccgctacggg
gccgccgccgcggaccgcctgggctactgggcctcccgggcgcgggaggtgctgacgtgg
gagaaggacttcacgcaggtgctggactggtccgaggccccggtggcgcggtggttcgcc
gacggcaccctcaacgccgcgtacaacgcgctggaccggcacgtggagaacgggctcggg
gaccgggtggcgatccacttcgaaggcgagccgggcgacacccgctcctacacctacgcg
cagctgaccgaggaggtcaagaaggccgcgaacgcgttcgagtccctcggcgttgccaag
ggcgaccgggtggccgtgtacctgccgatgatcccggaggcggtcatcaccatgctcgcc
tgcgcgaggatcggcgcgatccactcggtggtcttcggcggcttctccgccgaggccctg
cgcagccggatcgacgacgccgaggcgaagctggtcgtgaccgccgacggcaccttccgc
cgcggcaagccgagcccgctcaagcctgccgtggaccaggccctggccgagtccgggcac
accgtgcagaacgtcatcgtcgtgaagcgcaaccaccaggacgtggcgtggacgccaggg
ctggacaggtggtggcacgagaccgtgtccacggcgtccgccgagcacaccgcggtcgcg
cacgaggccgagcacccgctgttcatcctctacacctccggcaccaccggaaagcccaag
ggcatcctgcacaccaccggcggctacctggtccagggcgcggccacccacaaggacacc
ttcgacctgcacccggagaccgacgtctactggtgcacggccgacgtcggctgggtcacc
ggccactcctacgtcacctacgccccgctggtcaacggcgccacccaggtgatctacgag
ggcaccccggactgcccgcaccagggccgctggtgggagatcgtggaaaagtacggggtc
accatcctctacaccgccccgaccgcgatccgcaccttcatgaagtggggccgccagatc
ccggactcccacgacctctccagcctgcgcgtgctcggctcggtgggcgagtccatcaac
cccgaggcctggatgtggtaccgcgaggtcatcggatccaacaacggccccggcaccgac
ggagcgcccggtccgcgcaaggagcaccccgccccgatcgtggacacctggtggcagacc
gagaccggcgcgcacatgatcgccccgctgcccggggtcaccgcgaccaagcccggctcc
gcccaggtcccggtcccgggcatcggcgtcgacgtcgtggacgagatgggcgcaccggtg
cccaacggacagggcggcttcctggtcatccgcgagccgtggccggcgatgctgcgcggc
atctggggcgacatggaccgctaccaggacacctactggtcccgcttcgagcacatgtac
ttcgccggcgacggggccaagcgcgacgaggacggcgacatctggctgctgggccgcgtc
gacgacgtcatgaacgtctccggccaccgcctctccaccaccgagatcgaatccgccctc
gtctcccacccgctggtcgccgaggccgccgtcgtgggcgccaaggacgagaccaccggc
gaggccgtcgtcgcgttcgtcatcctccgcaccaccccgggcgagggcgaggacgtcgag
caagtcctgcgcgcccacgtggccaaggagatcggcccgatcgccaagccccggcacatc
ctcgcggtccccgaactgcccaagacccgctccggcaagatcatgcgccgcctgctcaag
gacgtcgccgaaggccgcgaccccggagacgccaccaccctggccgaccccaccgtcatg
gcccagatcgccgccgacctgcgcaagggctga

DBGET integrated database retrieval system