KEGG   Arthrobacter aurescens: AAur_1467Help
Entry
AAur_1467         CDS       T00447                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aau  Arthrobacter aurescens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AAur_1467 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_1467 (glk)
   00052 Galactose metabolism
    AAur_1467 (glk)
   00500 Starch and sucrose metabolism
    AAur_1467 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AAur_1467 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AAur_1467 (glk)
   00524 Butirosin and neomycin biosynthesis
    AAur_1467 (glk)
Enzymes [BR:aau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AAur_1467 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1610795..1611688
Genome map
AA seq 297 aa AA seqDB search
MGGTDIKAGLVDARGTVLGMRRVPTPLDPARPGEAVLDRLAELKAELASEFPEAPAKAAG
IIVPGIVDSVAGVGIYSANLGWRNFPFKAEAEKRLGIPVAFDHDVRSAAAVEHSFGGSKE
FNDVVVMVVGTGIAAAVFSGGKAVTAGGFAGELGHAQVPDPDAAPGATGSTILEAVGSAG
AIAKRYHRASGNTVDGARGVLLRAGAGDSVAARVWDDAVDALAFTICQCVNIIGTEAVVI
GGGLAEAGDELLEPLRKRVDGILDFQRRPQLIRAQLGQDAGLLGAALNARAVLGGAQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgggacggatatcaaggctggtttggtggacgcccggggaactgtcctgggcatg
cgccgcgtccctacgccgctggatccggcccgccccggcgaagcggtcctggacaggctc
gctgagcttaaagcagagttggcctcggagtttccggaagcccccgccaaggcagcaggc
atcattgtccccgggatcgtggactccgtggccggagtgggtatctactccgccaacctc
ggatggcgtaacttcccgttcaaagccgaagccgaaaaacggctcggcatccccgtcgcg
ttcgatcacgacgtccgttccgctgcggctgtggaacacagcttcggcggttccaaagag
ttcaacgatgttgtggtgatggtggtaggtaccggcatcgcagcagccgtgttctccggc
ggaaaggctgttaccgccggcggtttcgccggcgaactcggccacgcccaggtaccggac
cccgacgccgccccaggcgccaccggctccaccatcctggaagcagtgggctcagccggg
gccattgccaagcggtaccaccgggcatcgggaaacacggtggacggtgcacgcggagta
ctgctcagggcaggggcaggagactcagtcgctgcacgcgtttgggacgatgccgttgat
gcccttgctttcaccatctgccaatgcgtgaacatcattggtactgaagccgtggtaatc
ggcggaggcctcgctgaagccggcgacgaactgctcgagccgctccgcaaacgggttgac
gggatcctggacttccagcgtcggccccaacttatccgtgcccagctgggacaggacgca
ggcttgctcggtgcggccctgaatgcccgggcagtgttaggaggcgcacaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system