KEGG   Arthrobacter aurescens: AAur_1523Help
Entry
AAur_1523         CDS       T00447                                 

Definition
pyruvate dehydrogenase E2 (dihydrolipoamide acetyltransferase) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aau  Arthrobacter aurescens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AAur_1523
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_1523
   00020 Citrate cycle (TCA cycle)
    AAur_1523
   00620 Pyruvate metabolism
    AAur_1523
Enzymes [BR:aau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AAur_1523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1667462..1668874
Genome map
AA seq 470 aa AA seqDB search
MTATMIKEFRLPDLGEGLTESEILSWKVAVGDTVTLNQVIAEVETAKAVVELPSPFAGVV
AELHEQPGTVVEVGKPIVSFEVDDAGSSNGGGAPAAGDRSAGDRSVVDTAANGAPAAVAA
EAVGSPAKREPNLVGYGAVVEHSGRPTRRARGNVQDGKSLTPEAPAIAEPVVSRQADVAS
ERPRSTPPVRKLARDLGIDLQLVPGTGQGGLITREDVQSYIGAAETAQATPVSDGQNERE
SRTPIKGVRKFTAAAMVQSAFTAPHVTEFLTVDVTATMELLARLKGNKAFEGYKLTPLTI
AAKAVLVALRNNPTLNSRWDEASQEIVQFNYVNLGIAAATPRGLTVPNIKDADRLTLREL
STALTDLTDTARAGKTSPSELSGGTISITNIGVFGIDAGTPILNPGEAAIVALGAVRKAP
WVVNDELAVRQVMSLSLSFDHRLVDGEQGSRFLADLGAILADPAMVMTMI
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccatgatcaaggaattcaggctgccggaccttggcgaaggcctgaccgaa
tcggaaatcctgagctggaaggtagcggtgggggataccgttactctgaaccaggtcatc
gccgaggttgaaactgccaaggccgttgtcgagttgccctctcccttcgcgggagtggtg
gcagaacttcatgagcagcccggcactgtggtggaggttggcaagccaatcgtttcgttc
gaggtggacgacgccggatcctccaacgggggcggcgcaccggctgctggtgaccggtcc
gctggtgaccggtccgtcgtcgacacggctgcgaatggtgcgccggccgctgtcgccgct
gaagccgtggggagcccggcgaaacgagagccgaacctggtggggtacggggccgtcgtc
gaacattccggtcgcccaacacggcgtgcccgcggaaacgttcaggatggtaagtccctg
acgccggaggctccggcgatcgccgagcccgtcgtgtcacgtcaggcggacgtagcctcc
gagcgtccgcgttctacaccacccgttcgcaaactggcccgcgacctcggaatcgacctt
cagctggtgcccggtacgggtcagggcgggctcatcacccgcgaagacgtccaaagctac
atcggcgcagcggaaactgcccaggcaactcctgtttctgacgggcaaaatgagcgggaa
agccgcacgcccatcaagggtgttcgcaaattcacggccgccgcaatggtgcagagtgcc
ttcacggcaccgcacgtgacggagttcctcacagtggacgtcacggcaaccatggaattg
ctggcccggctcaagggcaacaaggcgttcgaaggctacaagctgacgccgctcaccatt
gcggccaaggcagtgctggtggcactgcggaacaatcccaccctgaattcgcggtgggat
gaggctagccaggagattgtccagttcaactacgtgaacctgggcatcgccgccgcaacg
ccccggggcctgaccgttccgaacatcaaggacgctgaccgcctaacgctgcgggaactt
tccacggcgctgactgacctgacggacaccgcgcgtgcaggcaaaacctcgccgtcggag
ttgtcgggtggcaccatctccatcaccaacatcggcgtgtttggcatcgacgccgggact
cctatcctgaatccgggggaggccgccattgtggctttgggtgcggtgcggaaggcgcca
tgggttgtcaacgacgaactcgccgtccgccaggtcatgtccctcagcctgtccttcgac
caccgcttggtggatggcgaacagggttctcggttcctcgcggatctcggcgccatactg
gccgaccccgccatggtcatgaccatgatctaa

DBGET integrated database retrieval system