KEGG   Arthrobacter aurescens: AAur_1688Help
Entry
AAur_1688         CDS       T00447                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aau  Arthrobacter aurescens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AAur_1688 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_1688 (glk)
   00052 Galactose metabolism
    AAur_1688 (glk)
   00500 Starch and sucrose metabolism
    AAur_1688 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AAur_1688 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AAur_1688 (glk)
   00524 Butirosin and neomycin biosynthesis
    AAur_1688 (glk)
Enzymes [BR:aau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AAur_1688 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1845512..1846570
Genome map
AA seq 352 aa AA seqDB search
MPALRSSSLVRTKPPASAWKEVPWAARRSHLGRRGLAIGIDIGGTKVAAGVVDADGRVLA
EARRSTPGADPRAVEQTIVELVDELSAGHRIASVGIGAAGWMDLDGGTVLFSPHLAWRNE
PLRESLQKLLRRPVLLTNDADAAAWAEWRFGAGQGESRLVCITLGTGIGGAMVMDGRVER
GRFGVAGEFGHQIIFPGGHRCECGNRGCWEQYASGNALGREARQLVRTNSPAGRALLEKA
GGTAENLSGAAVTSLALAGDATSRELLADQGDWLGLGLANLAAALDPGMFVIGGGLCDAG
ELLAAPARESFAKNLTGRGFRPMARIELAALGPRAGMIGAADLSRVSGRARS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcactacggtccagttccctggtcagaaccaagccaccggcctctgcctggaag
gaggtcccgtgggctgcccgccgcagccatttgggccgcaggggcctggcaatagggatc
gacatcggcggcaccaaagtggccgccggtgtggtggatgccgacgggcgggtcctcgcc
gaggcccgcaggtccacacccggtgccgaccccagggctgtcgagcagaccatcgtggaa
ctcgtggacgagctgagcgcaggacaccgcatcgcatcggtagggattggtgccgcagga
tggatggacctcgacggcggcacggtcctgttcagcccacaccttgcctggcgtaacgag
cccctgagggagagcctgcagaagttactgaggcgtcccgtgctgctcaccaatgacgcc
gatgccgcggcctgggcggagtggcgctttggtgctggccagggtgaaagccgcctggtc
tgcatcacactgggcacgggcataggcggcgccatggtcatggatggccgggtggagcgg
ggacgctttggcgtcgccggggagttcgggcaccagatcatctttcccggtggacaccgt
tgcgaatgcggtaaccgcgggtgctgggagcagtacgcctccggcaatgcgctggggcgt
gaagcccggcagttggtgcggaccaattccccggctggccgcgctttgctggagaaggca
ggcgggaccgcggagaacctgtccggggcggccgtgacctcgctggcgcttgcgggagat
gccacctcccgtgaactccttgccgaccaaggtgactggttggggctggggttggccaac
ctcgcagcggcgttggaccctggaatgttcgtgatcggcgggggcctgtgtgatgcgggg
gagttgctcgccgcaccagcacgggagtcgttcgccaagaacctgacgggcagggggttc
cgtcccatggcgaggatagaactcgcggccttgggcccgcgagccggcatgatcggcgcc
gccgacctttcacgggtcagcggccgggcgcgcagctga

DBGET integrated database retrieval system