KEGG   Arthrobacter aurescens: AAur_1691Help
Entry
AAur_1691         CDS       T00447                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
aau  Arthrobacter aurescens
Brite
Enzymes [BR:aau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AAur_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1847941..1848729)
Genome map
AA seq 262 aa AA seqDB search
MTERLIPAAPLAFQHAGHGANASIGVAICHGFTGSPLSVLPWAEYLAKQGFAVSVPLLPG
HGTSWQDLATTRWQDWYRTFERSYLDLAANTETCFVAGLSMGGAVALRVASRHEVPGLVL
VNPGLSFYDRRVRYVGALKYVMRTTTPIVEDTPTPVTTEDGDYSKTPLKSVHELKKLFRA
ATRGLPHVEAPALVFKSSVDDVIPPSSVATISKSIGSSRLKVVALPHSGHVATLDVDAPT
IFEESAGFFRQHAGDRVASESS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacgccttatacccgccgcgccgctcgcattccagcatgccggacacggagcc
aacgcatccataggagtggccatctgccacggcttcaccggaagccccctcagcgtcctc
ccctgggccgagtatctcgcaaagcagggctttgcggtgtccgtgcccctgctccccgga
cacggcaccagctggcaggacctcgccactacaaggtggcaggactggtaccggaccttc
gagaggagctacctggatctggcggcgaacaccgaaacgtgttttgtggcaggcctgtcc
atgggcggagccgtggctctgcgggtggcctcccgccatgaagttcccgggctggtcctg
gtgaacccggggctgagcttctatgaccgccgcgtgaggtatgtcggagcgctgaagtac
gtcatgcgcaccaccacccccatagtggaggacactcccacgccggtaacaaccgaggac
ggagactactccaagacaccgctgaagtctgtccacgaactcaagaaactcttccgcgct
gctacccggggcctcccgcacgttgaggctccggccctggtcttcaaatcctcggttgac
gacgtcatccctccgagctctgtggccactatcagtaagtcaatcggctcttcccgcctg
aaagtagtggcgcttccgcacagcgggcacgtagccaccctggatgtggatgcacccacc
atttttgaagaatcagccggctttttccgccagcatgccggggacagagtagcctcagag
tcatcatga

DBGET integrated database retrieval system