KEGG   Arthrobacter aurescens: AAur_1705Help
Entry
AAur_1705         CDS       T00447                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
aau  Arthrobacter aurescens
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:aau00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:aau00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1863748..1865358
Genome map
AA seq 536 aa AA seqDB search
MPDAGQTGFRPASVAAVPLATIADALGVAAPDASQDRGVTGITLNSRAVETGDLYMALPG
ASRHGADFVPQAVEAGAVAVVTDDAGARQLALAGEQPVPVLIVPEPRTAVGRLAALIYRS
QPADGGFPTLYGVTGTNGKTTTTYFINSLLRALEKKPGLIGTIEIVAGGEPIPSLLTTPE
STDVHALLALMRERGLDAASMEVSSHAISYHRVDGVMFDVAGFTNLTQDHLDLHGSMDEY
FRTKAELFTAGRARHAVVTVDDDWGRQLAETADIPVTTLSTKPVDGSSSSTDWKVASITA
RGLGSEFELKHADGRTLRVHTGLPGDFNVANAALATVMVLASGVDEHTLQAALDAHDPFT
VSVPGRMQLISTEPASVVDFAHNPDALSRALEAVRSPREGSRVIVVFGATGQRDKGKRPT
MGAIAARLADVVIISDDDPHDEDAAAIRAEVLQGAHAARDSENLNSEIIESYPRDAAIKL
AVDMATGKDTILIAGRGHEVWQEVKGVNLALDDRVELRAALTSKGFSVSADQRIES
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgccggatgccggccaaacaggctttcgtcccgcatccgtggccgcggtgccgctggca
accatcgcggacgcactcggtgttgccgctccggacgccagccaggacaggggagtgacg
gggattaccctgaactccagggccgtcgaaacgggcgacctctacatggctttgccggga
gcctcccgtcatggtgccgacttcgttccccaggcagtcgaggccggggcggttgcggtc
gtcacggacgacgccggggcccgccagcttgcgcttgcaggtgagcagcctgtgccggta
cttatcgtccctgagccgcgaaccgccgtcggacgtcttgccgcactgatctatcgcagc
cagcctgcggatggtggcttcccgacgctgtacggcgtcaccggtaccaacggcaagacc
accaccacctacttcatcaactccttgctgcgtgccttggagaagaagcccggcctcatc
ggaaccatcgaaatcgttgcaggaggcgagccgatccccagcctcctgaccacgccggaa
tccaccgacgtccatgcactgctggccttgatgcgcgaacgaggcctggacgcggcatcc
atggaggtctcgtcccacgccatctcctaccaccgcgtggacggagtgatgttcgacgtc
gccggttttaccaacctcacccaggatcatctggacctgcacggaagtatggacgagtac
ttccgcaccaaggctgagctcttcacagctggaagggccaggcacgcagtggtcacggtg
gacgacgactggggacgccagctggctgagacagccgatattccagtcaccacactctcc
accaagcctgttgatggaagcagctccagcaccgactggaaggttgcgtccatcacggcg
cgcggactgggctcggaattcgaactcaagcacgctgacggacgaaccctgcgcgtccac
accggcctgccgggagacttcaatgtggccaacgcggccctggccacagtgatggtcctt
gcatccggtgtggacgaacacacgctccaggctgccctggatgcgcacgatcccttcaca
gtgtcagtgcccggacgaatgcagctcatctctactgagcctgcctccgttgttgatttt
gcccacaaccctgacgccttgtcccgtgccttggaagccgttcgctcaccccgggagggg
tcccgcgtcatcgtggtcttcggggcaacaggccaacgcgacaaaggcaagcgccccacc
atgggagccatcgctgcccgcctcgcagacgtcgtgatcatcagcgatgacgatccccac
gacgaagacgctgcagcaatccgggctgaggtcctccaaggcgcccatgcggcccgggat
tcagagaatctgaacagcgaaatcatcgagtcctacccgagggatgccgccattaaattg
gccgtcgacatggcaaccggcaaggacaccatcctgatcgccgggcgtggacatgaggtg
tggcaagaggtcaagggagtgaacctggccctggacgacagggtggagttgcgggccgcc
ttgacatccaagggattcagcgtttcagcggaccagcggatagagtcctaa

DBGET integrated database retrieval system