KEGG   Arthrobacter aurescens: AAur_1724Help
Entry
AAur_1724         CDS       T00447                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aau  Arthrobacter aurescens
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AAur_1724 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    AAur_1724 (hisD)
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AAur_1724 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1885510..1886874
Genome map
AA seq 454 aa AA seqDB search
MTTSSDTSAPTTDALNFRSIDFRGRHLSLAELRAAVPRAQHQTMADAEQKVLDIIADVRS
RGFAALGELAKKFDGVVQSHPRVPAEALTQALTDLDPKVRAALEESIKRARQFADQQRPA
NVDVQLGDGAVVSQNWIPVGRVGLYVPGGLAPLASSVIMNVVPAVAAGVESIALASPPQK
DFGGLPHPTILAAAKLLGIDEVYAIGGAQAIVSFAYGIPGTDDELPLEPVDVVTGPGNIF
VATAKRLVKGVVGIDSEAGTTEIAILADSTAQAPLVAADLISQAEHDPKAASVLVTDSAE
LADAVVLELSRQAAATKHSARVLEALSGPQSGVVLVDDLEQGIAVCNAYAAEHLEIMTAN
APTVASRIRNAGAIFVGDFSPVSLGDYCAGSNHVLPTSGTAAFSSGLNVTTFLRAVQVIN
YDRAALAQVSGHIVSLSGAEDLPGHGDAVRIRFA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacttcctcggatacttccgcccccaccactgacgccctgaacttccgaagcatc
gacttccggggccgccacctttcgttggcggaacttcgcgcagctgtgccaagggcgcag
catcagacaatggcggacgcggagcagaaggtcttggacatcattgccgatgtccgcagc
cggggcttcgccgccttgggtgagctggcgaagaagttcgacggcgtggtgcagtcccac
ccccgggttccggcggaggccctcacccaagcgctgaccgatctcgatccgaaggtccgt
gcggccctggaggagtccatcaagcgcgcccgccagtttgctgaccagcagcggcccgcc
aatgtggatgtacaacttggcgacggcgccgtcgtcagccaaaactggataccagtggga
cgcgttgggctctacgttcccggcggactcgcccctttggcgtcatcagtcatcatgaat
gtcgtccccgcagttgccgccggcgttgagtccattgcactggcctctcctccgcagaaa
gacttcggtggcctacctcaccccaccatcctggccgcagcgaagctgttgggcatcgac
gaggtgtacgccatcggtggtgcgcaggccattgtgtcgtttgcctacggaatcccggga
accgacgatgaactgccccttgagcctgttgacgtggttacaggccccggaaacattttt
gtggccacagccaaacgactcgtcaagggtgtggtgggcatcgactccgaggctggaacc
actgagatcgccatcctcgccgactccacggcgcaggccccgttggtggccgccgacctc
atcagccaggcggagcacgatcccaaagcagcttccgtcctggtgacggactccgcggaa
ctggctgacgccgtcgtgcttgaactgtcacggcaggccgctgcaacaaagcacagtgcc
cgcgtccttgaggcgctgtccggaccacagtccggtgtggtgctggtggatgatcttgag
caggggatcgcggtttgcaatgcctacgccgctgaacacctggagatcatgacggcgaac
gcacccactgttgcatcgcggatccgcaacgcgggggcgatcttcgtgggcgacttcagc
ccggtgagcctgggggactactgcgcaggttccaaccacgtgctgcccaccagcggaacc
gcggcattctcttcgggcctcaacgtcaccacgttcctccgggcggtccaggtcatcaac
tatgaccgcgctgcgttggcgcaagtcagcggacacattgtgagcctgtcgggcgccgaa
gacctgccgggtcatggtgacgctgtccgaattcgcttcgcttag

DBGET integrated database retrieval system