KEGG   Arthrobacter aurescens: AAur_1744Help
Entry
AAur_1744         CDS       T00447                                 

Gene name
glnA
Definition
glutamine synthetase (EC:6.3.1.2)
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
aau  Arthrobacter aurescens
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AAur_1744 (glnA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AAur_1744 (glnA)
  Energy metabolism
   00910 Nitrogen metabolism
    AAur_1744 (glnA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AAur_1744 (glnA)
   00330 Arginine and proline metabolism
    AAur_1744 (glnA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AAur_1744 (glnA)
Enzymes [BR:aau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamate---ammonia ligase
     AAur_1744 (glnA)
Exosome [BR:aau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AAur_1744 (glnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1905320..1906744)
Genome map
AA seq 474 aa AA seqDB search
MFKTADEVLKFIKDEDVKFVDIRFTDLPGVQQHFNVPAKSVDLDFFVHGQLFDGSSIRGF
QGIAESDMQLIPDVTSAFIDTFRIEKTLALNFSIVNPRTGDPYHRDPRGVAEKAEAYLAS
TGIADTAFFAPEAEFFVFDNIQYESSPQGSFYKIDSEEAHWNTGRKEEGGNLGYKTPVKG
GYFPVSPTDKQADLRDAMCIELDKAGLEVERSHHEVGSAGQAEINYKFTTLTAAADDLQK
FKYIIKNTADAWGKSVTFMPKPVFGDNGSGMHCHQSLWSNGDPLFYDEKGYAGLSDTARW
YIGGLLKHSSAVLAFTNPTVNSYRRLVKGFEAPVNMVYSQGNRSAGIRIPITGTNPKAKR
IEFRAPDPSSNPYLAFAAQLMAGIDGIRNRIEPPAPIDKDLYELPAEEAKDIPKAPGTLE
EALEALREDNEFLQAGGVFTQDLIDTWIDYKYENEIRPLSLRPNPYEFELYYGV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagactgcggacgaagtcctcaagttcatcaaagacgaagacgtcaaattcgtc
gatatccgcttcaccgaccttcctggtgtccagcagcacttcaacgtgccggccaagagt
gtcgacctcgatttcttcgtccacggccagctcttcgacggatcttcaatccgcggcttc
cagggcatcgccgagtccgacatgcagctcatcccggatgtgacctcggctttcatcgac
accttccgcattgagaagacgctcgcactgaacttctccatcgtgaacccccgcaccggt
gacccgtaccaccgcgatccccgcggcgtggcagagaaggctgaagcgtacctggcatcc
acaggcatcgccgacaccgcgttcttcgctcccgaagccgaattcttcgtcttcgacaac
atccagtacgagtcctccccgcagggcagcttctacaagatcgactctgaagaagcacac
tggaacaccgggcgcaaggaagagggcggaaacctcggatacaagacccccgtcaagggc
ggttacttcccggtctcccccaccgacaagcaggccgaccttcgcgacgccatgtgcatc
gagctggacaaggccggccttgaggtcgagcgctcccaccacgaagttggatccgccggc
caggctgagatcaactacaagttcaccacgctgaccgcggctgctgatgacctgcagaag
ttcaagtacatcatcaagaacaccgcagatgcttggggcaagtccgtcacgttcatgccg
aagcccgtcttcggtgacaacggctcgggcatgcactgccaccagtcgctgtggagcaac
ggcgatccgctgttctatgacgagaagggctacgccggcctttccgacaccgctcgctgg
tacatcggtggcctgctgaagcactcttccgcagtcctggccttcaccaacccgacggtt
aactcctaccgccgcctggtcaagggcttcgaagctccggtgaacatggtctactcgcag
ggcaaccgctccgctggtatccgtatcccgatcacgggcaccaacccgaaggccaagcgc
attgagttccgcgcgccggacccctcatccaacccgtacctggcgttcgctgcacagctg
atggccggcatcgacggtatccgcaaccgcattgagcccccggctcccatcgacaaggac
ctctacgagctcccggccgaggaagccaaggacatccccaaggctccgggcaccctggaa
gaagcacttgaggccctgcgcgaggacaacgagttcctccaggccggcggcgtcttcacc
caggacctcatcgatacttggattgactacaagtacgagaatgagatccgcccgctgtca
ctgcgcccgaacccctacgagttcgagctctactacggcgtctag

DBGET integrated database retrieval system