KEGG   Arthrobacter aurescens: AAur_1744Help
Entry
AAur_1744         CDS       T00447                                 

Gene name
glnA
Definition
glutamine synthetase (EC:6.3.1.2)
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
aau  Arthrobacter aurescens
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aau01230]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:aau00630]
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:aau00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aau00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aau00330]
Environmental Information Processing; Signal transduction; Two-component system [PATH:aau02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1905320..1906744)
Genome map
AA seq 474 aa AA seqDB search
MFKTADEVLKFIKDEDVKFVDIRFTDLPGVQQHFNVPAKSVDLDFFVHGQLFDGSSIRGF
QGIAESDMQLIPDVTSAFIDTFRIEKTLALNFSIVNPRTGDPYHRDPRGVAEKAEAYLAS
TGIADTAFFAPEAEFFVFDNIQYESSPQGSFYKIDSEEAHWNTGRKEEGGNLGYKTPVKG
GYFPVSPTDKQADLRDAMCIELDKAGLEVERSHHEVGSAGQAEINYKFTTLTAAADDLQK
FKYIIKNTADAWGKSVTFMPKPVFGDNGSGMHCHQSLWSNGDPLFYDEKGYAGLSDTARW
YIGGLLKHSSAVLAFTNPTVNSYRRLVKGFEAPVNMVYSQGNRSAGIRIPITGTNPKAKR
IEFRAPDPSSNPYLAFAAQLMAGIDGIRNRIEPPAPIDKDLYELPAEEAKDIPKAPGTLE
EALEALREDNEFLQAGGVFTQDLIDTWIDYKYENEIRPLSLRPNPYEFELYYGV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagactgcggacgaagtcctcaagttcatcaaagacgaagacgtcaaattcgtc
gatatccgcttcaccgaccttcctggtgtccagcagcacttcaacgtgccggccaagagt
gtcgacctcgatttcttcgtccacggccagctcttcgacggatcttcaatccgcggcttc
cagggcatcgccgagtccgacatgcagctcatcccggatgtgacctcggctttcatcgac
accttccgcattgagaagacgctcgcactgaacttctccatcgtgaacccccgcaccggt
gacccgtaccaccgcgatccccgcggcgtggcagagaaggctgaagcgtacctggcatcc
acaggcatcgccgacaccgcgttcttcgctcccgaagccgaattcttcgtcttcgacaac
atccagtacgagtcctccccgcagggcagcttctacaagatcgactctgaagaagcacac
tggaacaccgggcgcaaggaagagggcggaaacctcggatacaagacccccgtcaagggc
ggttacttcccggtctcccccaccgacaagcaggccgaccttcgcgacgccatgtgcatc
gagctggacaaggccggccttgaggtcgagcgctcccaccacgaagttggatccgccggc
caggctgagatcaactacaagttcaccacgctgaccgcggctgctgatgacctgcagaag
ttcaagtacatcatcaagaacaccgcagatgcttggggcaagtccgtcacgttcatgccg
aagcccgtcttcggtgacaacggctcgggcatgcactgccaccagtcgctgtggagcaac
ggcgatccgctgttctatgacgagaagggctacgccggcctttccgacaccgctcgctgg
tacatcggtggcctgctgaagcactcttccgcagtcctggccttcaccaacccgacggtt
aactcctaccgccgcctggtcaagggcttcgaagctccggtgaacatggtctactcgcag
ggcaaccgctccgctggtatccgtatcccgatcacgggcaccaacccgaaggccaagcgc
attgagttccgcgcgccggacccctcatccaacccgtacctggcgttcgctgcacagctg
atggccggcatcgacggtatccgcaaccgcattgagcccccggctcccatcgacaaggac
ctctacgagctcccggccgaggaagccaaggacatccccaaggctccgggcaccctggaa
gaagcacttgaggccctgcgcgaggacaacgagttcctccaggccggcggcgtcttcacc
caggacctcatcgatacttggattgactacaagtacgagaatgagatccgcccgctgtca
ctgcgcccgaacccctacgagttcgagctctactacggcgtctag

DBGET integrated database retrieval system