KEGG   Arthrobacter aurescens: AAur_1839Help
Entry
AAur_1839         CDS       T00447                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aau  Arthrobacter aurescens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AAur_1839 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AAur_1839 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AAur_1839 (trpB)
Enzymes [BR:aau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AAur_1839 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2004801..2006186
Genome map
AA seq 461 aa AA seqDB search
MRLMVDAPTAGSEENAADAFLQGGPSLRNASGPYFGSYGGRWMPESLIAALDEVQDTFEK
AKADPDFIAQLKDLNKNYSGRPSLLTEAKRFSEHAGGARIFLKREDLNHTGSHKINNVLG
QALLAKRMGKTRVIAETGAGQHGVASATAAALLGLECVVYMGAEDCRRQALNVARMQLLG
ATVVPVTNGSQTLKDAINDALRDWVSNVEHTHYLLGTAAGAHPFPAMVRYFHEVIGEEAR
SQILEQTGKLPDAIAACIGGGSNAIGLFHAFLDDASVKIYGFEAGGEGVETGRHAAAISL
GRPGVLHGARSYLMQDEDGQTIESHSISAGLDYPSVGPEHSYLADIGRVTYEAVTDTEAM
DAFSLLCRTEGIIPAIESSHALAGAIKIGKRLTEGKETPSDVTVIVNLSGRGDKDVETAA
AWFNMLDEEGHVKGTTLSTRKPKGPTEHTSEAAVDVNEDQK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgagactgatggtcgacgcgccaacagccggctcagaagagaatgcggcggacgcattc
ctccaaggtggcccttcgctgcggaatgcatcggggccctactttggcagctatggcgga
cgctggatgcccgagtcgctcatcgccgcccttgacgaagtccaagacacttttgagaaa
gccaaagctgatcccgatttcatcgctcagctgaaggacctcaacaagaactactccggc
aggccttccttgctgaccgaagccaagcgcttctcggagcacgccgggggagcacgtatt
ttcctcaagcgcgaggacctcaaccacactggctcccacaagatcaacaacgtcctgggc
caggcactcctcgcgaagcgcatgggcaagacccgcgttatcgctgagaccggtgccggt
cagcacggcgttgcgagtgccacggccgcagccctgctgggcctcgagtgcgtggtgtac
atgggtgcggaggattgccgtcggcaggccttgaacgtggcccgcatgcagctgctgggc
gccacggttgttccggtaaccaatggttcccagacgctcaaggacgccattaacgatgcc
cttagggattgggtctccaacgtggagcacacccactaccttctgggcacagcagccggt
gcgcaccccttccccgccatggtccgctacttccacgaagttatcggcgaagaagcgcgc
agccagatcctggagcaaaccggcaagctccctgacgccattgctgcatgtatcggtggc
ggctccaacgccattggtttgttccacgctttccttgatgacgcttccgtgaagatctac
ggctttgaggccggtggcgaaggtgtggaaacgggccgccacgcggctgccatttccctg
ggccgtccaggcgtactgcacggtgcccgctcctacctcatgcaggacgaggacggccag
accatcgagtcccactccatttcggccggcttggactacccgagcgttggtccggagcac
tcgtacctggccgacatcgggcgcgtaacctatgaggccgttaccgacacagaggccatg
gatgccttcagcctcctctgccggaccgagggcatcattcccgccattgagtcctcgcac
gccctggccggtgccatcaagatcggcaagcggctcacggagggcaaggaaactccctcg
gacgtgacggtgatcgtcaatctgtccggacgcggtgacaaggacgtggagactgccgct
gcctggttcaacatgttggacgaggaagggcacgtcaagggcactacgctgtccacgcga
aagcccaagggaccaactgagcacacgtccgaagcagccgtggatgtcaacgaggaccag
aagtga

DBGET integrated database retrieval system