KEGG   Paenarthrobacter aurescens: AAur_1840Help
Entry
AAur_1840         CDS       T00447                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aau  Paenarthrobacter aurescens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AAur_1840 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AAur_1840 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AAur_1840 (trpA)
Enzymes [BR:aau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AAur_1840 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2006186..2006998
Genome map
AA seq 270 aa AA seqDB search
MTEEFASKSAGAIDRAKADGRAALVGYLPAGYPTVQESIEAGIALARNGADLIEIGIPYS
DPVMDGPVIQAATTEAISNGFRVSNVFDVVAGITAATDAAVLVMTYWNPVMRMGVDEFSR
RLAEAGGAGLITPDLVPDEAHEWFEASDKYGLDRVFLVAPSSTPERLDMTVKASRGFVYA
VSIMGVTGTRTSVSSSAQDVVARAHAAGAERVCVGLGVSNPDHVREIAAYADGVIVGTAL
VAALRDGGVDAVGQLTKNLSAGLGRAAAEA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaattcgccagcaaatccgcaggcgccattgaccgcgcaaaagcagacggc
cgcgccgcgctggtgggctacctccccgcgggctacccgacggttcaggagagcatcgag
gccggcatagccctggcccgcaacggtgctgacctcatcgaaatcggcattccgtattcc
gatccagtgatggacggccctgtcatccaggccgctaccaccgaagcgatttccaacgga
ttccgggtgtccaacgtctttgacgtggttgccggcattaccgcagctactgatgcggcc
gttctggtcatgacgtactggaaccctgtcatgcgcatgggcgtggacgagttttctcgc
cgtttggccgaggccgggggagcagggctcatcaccccggacctggtcccggacgaggct
catgagtggttcgaagcctcagataagtacggcttggaccgggtgttccttgtggcgccc
tcgtccactccggagcgactggacatgacggtcaaggcaagccgcggcttcgtctacgct
gtctcgatcatgggtgtcaccggaacgcgcacctccgtcagcagcagcgctcaagacgta
gtggcccgcgcccatgcggccggtgccgaacgcgtttgcgtggggttgggcgtctccaac
ccggatcacgtccgcgaaatcgctgcctatgcggacggcgtgatcgtgggtacggctttg
gtggcggccctccgcgatggcggcgtggacgccgtcggacaactcaccaagaacctcagc
gccggcttgggccgcgcagctgcagaagcctag

DBGET integrated database retrieval system