KEGG   Paenarthrobacter aurescens: AAur_1840Help
Entry
AAur_1840         CDS       T00447                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00260  Glycine, serine and threonine metabolism
aau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01130  Biosynthesis of antibiotics
aau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AAur_1840 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AAur_1840 (trpA)
Enzymes [BR:aau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AAur_1840 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA KDGP_aldolase His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ABM07707
UniProt: A1R5S9
Position
2006186..2006998
Genome map
AA seq 270 aa AA seqDB search
MTEEFASKSAGAIDRAKADGRAALVGYLPAGYPTVQESIEAGIALARNGADLIEIGIPYS
DPVMDGPVIQAATTEAISNGFRVSNVFDVVAGITAATDAAVLVMTYWNPVMRMGVDEFSR
RLAEAGGAGLITPDLVPDEAHEWFEASDKYGLDRVFLVAPSSTPERLDMTVKASRGFVYA
VSIMGVTGTRTSVSSSAQDVVARAHAAGAERVCVGLGVSNPDHVREIAAYADGVIVGTAL
VAALRDGGVDAVGQLTKNLSAGLGRAAAEA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaattcgccagcaaatccgcaggcgccattgaccgcgcaaaagcagacggc
cgcgccgcgctggtgggctacctccccgcgggctacccgacggttcaggagagcatcgag
gccggcatagccctggcccgcaacggtgctgacctcatcgaaatcggcattccgtattcc
gatccagtgatggacggccctgtcatccaggccgctaccaccgaagcgatttccaacgga
ttccgggtgtccaacgtctttgacgtggttgccggcattaccgcagctactgatgcggcc
gttctggtcatgacgtactggaaccctgtcatgcgcatgggcgtggacgagttttctcgc
cgtttggccgaggccgggggagcagggctcatcaccccggacctggtcccggacgaggct
catgagtggttcgaagcctcagataagtacggcttggaccgggtgttccttgtggcgccc
tcgtccactccggagcgactggacatgacggtcaaggcaagccgcggcttcgtctacgct
gtctcgatcatgggtgtcaccggaacgcgcacctccgtcagcagcagcgctcaagacgta
gtggcccgcgcccatgcggccggtgccgaacgcgtttgcgtggggttgggcgtctccaac
ccggatcacgtccgcgaaatcgctgcctatgcggacggcgtgatcgtgggtacggctttg
gtggcggccctccgcgatggcggcgtggacgccgtcggacaactcaccaagaacctcagc
gccggcttgggccgcgcagctgcagaagcctag

DBGET integrated database retrieval system