KEGG   Arthrobacter aurescens: AAur_1848Help
Entry
AAur_1848         CDS       T00447                                 

Gene name
xfp
Definition
phosphoketolase (EC:4.1.2.22 4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
K01632  
fructose-6-phosphate phosphoketolase [EC:4.1.2.22]
Organism
aau  Arthrobacter aurescens
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:aau00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2018415..2020796
Genome map
AA seq 793 aa AA seqDB search
MISTLQLQDLLPVSTLNRRRQQSPRSRFNRPCRQPLQAAHIKPRLLGHWGTSPGLSLIYA
HLNRLIRRTSVEVLFVAGPGHGGPAVVANTYLEGSYSEVYPAVGKDLKGLRRLVRQFSTP
GGIASHVGPATPGSIHEGGELGYSLMHATGAAMDNPDLIVACVVGDGEAETGPLEGSWKA
PSFINPLRDGAVLPILHLNGHKISGPTVLGRRSNMAVASLLEAHGWDPVIVSGDDPALVH
PALASALDSAYLSIRTIQSHARTEGVTGPARWPAIVLRTPKGWTGPVTVDGKPVEGTHRS
HQVPLAGVRENPAHLAQLEAWMRSYRPEELFDADGRLIAELTALAPDGDLRMGALPASRG
MGSRDLAIPSLDRYALEAVPRGGVMHGSTKPLGEMLRDIYIDTADDPRFRLFCPDETNSN
RLGAVFEATDRCLLEPAATTEAALADDHVSASGRVMEVLSEHLCQGWLEGYVLTGRHGLF
ASYEAFAMVSASMTVQHAKWLQHSRELEWRRPVPSLNILLTSTCWRNDHNGFSHQGPGLI
DTVLSLSSSVIRVYFPPDANTLLVTAEHMLESKDYVNLVVIDKQEHPQYLTLEEARAHAA
VGASIWDWAGHEILGTSAGKVPDIVLACAGDVPTQETLAAAWLLRRHVPEMSVRVVNVMD
AMVLPPPEAHPHGLSGEKFEELFTADVDVVMAWHGYARALHQLLHGRPHPERFHVRGYNE
QGTTTTPFDMVVLNKVSRYHLVMEALRRTRGQFPGAEQLLEHCRQQLDAHSLYIREHFED
LPEIRDWVWTQQQ
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtaccctccaactccaagatttactcccagtctcaaccctgaatcggcgccgc
caacagagtccgaggtcccggttcaatcgcccgtgccgccaaccgctgcaagcagcgcac
atcaaacccagacttctaggtcactggggcacaagccccgggctgtccctgatctatgca
cacctcaaccgccttatccgtcgcacgagtgtggaagttctgttcgtggccggtcccggc
cacggaggtcccgccgtcgtcgccaatacctatctggaaggcagctactcggaggtttac
ccggccgttggcaaagacctgaaagggcttcggaggcttgtccggcagttttcgacgccg
ggaggcatcgccagccacgtcggccccgccacgcctggctccattcacgagggcggggaa
ctgggctactccctgatgcatgctaccggtgcggctatggacaatccggacctgatcgtt
gcctgcgtcgtcggtgatggggaggccgaaaccggtccgctcgaaggctcttggaaggcg
ccctcgttcatcaacccgctcagggatggggcagtacttcccatcctccacctcaatggg
cataagatctccggccccacggtccttggcaggcgctcgaacatggccgttgcgtcgctt
ttggaagcgcacggctgggatcccgtgattgtctccggcgacgatcccgcccttgtccac
cccgccctcgcctcagctctggattcagcctacttatcgatccggaccattcagtcccat
gcccgcacagagggagtcaccgggcccgcacgatggccggccatcgtcctgcgcaccccc
aaaggatggacaggaccggtgacagtagacggaaagcccgtagagggaacccaccgttcc
caccaagtcccgctggccggagtcagagagaatccggcgcacctggcgcagcttgaagcg
tggatgcgttcctaccggccggaagaactcttcgacgccgacgggcggcttatcgccgag
ctgacggcgctcgcccccgacggcgatttacgcatgggcgcactgcccgccagccgcggg
atgggaagccgcgacctggcaataccatcgctcgatcgatatgccctcgaagctgttccc
cgcggaggcgtgatgcacgggagcaccaagccattaggggagatgctgcgcgatatctac
atcgatactgccgatgaccccaggttccgcctcttctgccccgatgaaaccaacagcaac
agactcggtgcagtctttgaagccaccgacagatgcctcctcgaaccagccgcgaccaca
gaagccgcgctcgcagacgatcatgtttccgccagcggacgcgtgatggaagtcctgtcc
gaacacttgtgccaagggtggctggaaggatacgtgctgacaggccgccacggcctattc
gccagctatgaggcgtttgcgatggtcagcgcttccatgaccgttcagcacgccaaatgg
ttgcagcattcacgggagctggagtggcggcggcccgtgcccagcttgaacatcctgctg
acctccacttgttggcggaacgatcacaacggtttcagccatcaaggccctggtcttatt
gacacggttctgtccctgtccagcagcgtcatccgtgtctacttcccacccgatgcgaac
accctgctggtcactgccgaacacatgctcgaaagcaaggactatgtgaatctggtagtg
atcgataagcaggaacatccgcagtacctgacgctcgaagaggcgcgggcgcatgcagcc
gtcggtgcatccatctgggattgggctggacatgaaatactcgggacctcggccggtaag
gtcccggacatcgtccttgcatgtgccggagatgttcccacgcaggagacgttggcggct
gcgtggctcctcaggcggcatgttcctgagatgtccgtccgggtagtcaatgtcatggat
gccatggtcttgccgccgccagaggcgcatccgcatgggctgtctggtgagaagtttgaa
gaactcttcaccgctgatgtggatgtcgtgatggcctggcatgggtacgcgagggcactg
caccagctcctgcatggtcgcccgcatcccgagcggttccatgtccggggatacaacgag
caaggcaccaccaccacaccattcgacatggtggtactgaacaaggtcagccgataccac
ctggtgatggaagccctgcgccggactcgcggtcaattcccgggggcagagcaactgctg
gagcattgccggcagcagttggacgcccattccctctacatccgcgagcactttgaggac
ctacccgaaatcagggattgggtgtggacgcagcagcagtag

DBGET integrated database retrieval system