KEGG   Arthrobacter aurescens: AAur_1867Help
Entry
AAur_1867         CDS       T00447                                 

Gene name
fdhA
Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
aau  Arthrobacter aurescens
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aau01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:aau00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:aau00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2039416..2040564)
Genome map
AA seq 382 aa AA seqDB search
MKAVVYKGPNDVSVEDVPDAKIERPADVLVRITSSNICGSDLHMYEGRTSFETGRTFGHE
NLGEVIEVGSAVSKVKVGERVVLPFNIACGFCKNCERGFTNYCLTMQPEPKLAGAAYGFA
DMGPYQGGQAEYLRVPYGDFNCLRLGEDAEEKELDYVMVADIFPTGWHATEMAGVYPGDS
VVIYGAGPVGLMAAYSAIIKGAGKVMVVDRQSDRLKLAEQIGAIPVDDSKVDPVEFVKDQ
TMGFGADRGCECVGYQAHDPSGNEQPNLTLNRLVDSVRFVGGLGVVGVFLPQDPGAPDEL
AKQGQVAFDYGNYWFKGQTMGSGQCPVKKYNRALRDLIAGGKASPSFLVSHELPLDKAPE
AYRNFDDRVDGWTKVVLHPAGS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtagtctacaaaggaccgaacgatgtcagcgtcgaggacgtacctgacgcc
aagattgagcgccccgccgacgtgttggtgcgaataacgtcgtcgaatatttgcggttcc
gatctgcatatgtacgagggccgcaccagcttcgaaaccggacgcaccttcgggcacgag
aacctcggtgaagtgatcgaggtcggctcagcagtgagcaaggtcaaggtgggcgaacgg
gtggtactgccgttcaacatcgcctgcggattctgtaagaactgtgaacggggcttcacc
aactactgcctgaccatgcagcccgaacccaagctcgccggcgcggcgtacgggttcgcg
gacatgggcccgtatcaaggcggacaggccgagtacctgcgcgtgccgtacggagacttc
aactgcctgcgtttgggcgaggacgccgaggagaaggaactcgactatgtcatggtcgcg
gacatcttccccaccggatggcacgcaaccgagatggccggcgtttaccccggcgactcg
gtagtcatctacggcgcagggccagtaggacttatggcagcctactcggccatcatcaag
ggcgccggaaaagtcatggtggtggaccggcaaagtgaccgcttgaagcttgccgaacag
atcggtgccatccctgtagacgattccaaagtggaccctgttgagttcgtcaaagaccaa
accatggggttcggggctgaccggggttgcgagtgcgtcgggtaccaagcccacgacccg
agcggaaacgaacagcccaacctgacgttgaaccgcctggtggactccgtccggttcgtc
ggcggcctaggcgtagtaggcgtgttcctgccgcaggatcctggagccccggacgaacta
gccaagcaggggcaggtggccttcgactacggaaactactggttcaaaggacaaacgatg
ggctccggtcagtgcccggtcaagaaatacaaccgggcccttcgcgacctcattgccggc
gggaaggccagcccctccttcctcgtcagccacgaactgccactggacaaggccccggag
gcctacaggaacttcgatgaccgcgtcgacggttggaccaaagtggtcctccacccggcc
ggctcctag

DBGET integrated database retrieval system