KEGG   Paenarthrobacter aurescens: AAur_2090Help
Entry
AAur_2090         CDS       T00447                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00010  Glycolysis / Gluconeogenesis
aau00051  Fructose and mannose metabolism
aau00562  Inositol phosphate metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01130  Biosynthesis of antibiotics
aau01200  Carbon metabolism
aau01230  Biosynthesis of amino acids
Module
aau_M00002  Glycolysis, core module involving three-carbon compounds
aau_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_2090 (tpiA)
   00051 Fructose and mannose metabolism
    AAur_2090 (tpiA)
   00562 Inositol phosphate metabolism
    AAur_2090 (tpiA)
Enzymes [BR:aau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AAur_2090 (tpiA)
Exosome [BR:aau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AAur_2090 (tpiA)
  Exosomal proteins of bladder cancer cells
   AAur_2090 (tpiA)
  Exosomal proteins of melanoma cells
   AAur_2090 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABM09344
UniProt: A1R6H2
Position
2302153..2302968
Genome map
AA seq 271 aa AA seqDB search
MTTSANGNFIRKPFIAGNWKMNMDHVQGITLLQKLAWTLSDAKHDYNRAEVAVFPPFTDL
RGVQTLVQGDELEIVYGGQDLSQFDSGAYTGDISGQFLSKLGCAYVLVGHSERRTIHNES
DEVLNAKVKAAFRHGLTPVLCVGEGLEVRQAGTHVEHTLAQLRAGVEGLTAEQAAELVVA
YEPVWAIGTGEVAGPEDAQEMCAAIRAELAELFDETVAGKTRLLYGGSVKANNAAAIMAE
SDVDGLLVGGASLDPAEFANIVRFESHLVTD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgactacctctgctaacggcaacttcatccgcaagcccttcatcgccggcaactggaag
atgaacatggaccacgtccagggcatcaccttgctgcagaagctcgcgtggacactgtca
gacgccaagcacgactacaaccgtgcggaggttgcagtattccctccgttcaccgacctc
cgcggtgtccagacactcgtacagggtgatgaactggaaattgtctacggtggccaggat
ctgtcccagttcgactccggcgcttacacgggtgatatctccggtcagttcctcagcaag
ttgggctgcgcctacgtattggtgggccacagtgagcgccgcactatccacaacgagtct
gacgaggttttgaacgccaaggtcaaggccgccttccgccatggacttactcccgtactg
tgcgtcggtgagggccttgaagtccgtcaggcgggcacacacgttgaacacaccttggcc
cagctgcgtgccggtgtggaaggcctcacggctgagcaagctgctgaactcgttgtggct
tacgaacccgtctgggccatcggtaccggcgaagttgctggcccggaagacgcacaggaa
atgtgcgctgcaatccgtgccgagcttgccgaactcttcgatgagactgtcgcagggaag
acgcgcctcctttatggcggctccgtcaaggccaataatgctgccgccatcatggccgaa
agcgacgttgacggattgcttgtgggtggcgccagcctggaccccgccgagtttgctaac
attgtcaggttcgagagccacctcgtcacggactag

DBGET integrated database retrieval system