KEGG   Arthrobacter aurescens: AAur_2164Help
Entry
AAur_2164         CDS       T00447                                 

Gene name
rfbC_rfbD
Definition
dTDP-4-keto-L-rhamnose reductase/dTDP-4-keto-6-deoxyglucose-3,5-epimerase (EC:1.1.1.133 5.1.3.13)
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
aau  Arthrobacter aurescens
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:aau00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:aau00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2382843..2384252)
Genome map
AA seq 469 aa AA seqDB search
MKPGEQLHSRTTPIPGLLLFELAVHGDERGWFKENWHRAKMRDIGLPDFGPVQNNISFNA
ARGTIRGFHAEPWDKFVSLASGRIFGAWVDLREGPTFGTSFCAELTAHDAVFVPRGVGNA
FQTLEDDTAYTYLVNDHWSAEAQRDYTFLNLADEHVAVPWPIPLKSAILSPQDKKHPRLA
DVVPMPGRRTLVLGAEGQLGTALRHAFEGDATVEFAGRAQFDITSEASYRAVNWRSYSAV
INAAAFTAVDAAETPEGRAAAWNINATAVSRLARAAVEHSLTLVHVSSDYVFDGTAEVHF
EDEMPTPLGVYGQSKAAGDAAVAAVQKHYIVRTSWVVGEGRNFVRTMASLAAKGASPSVV
DDQWGRLSFAKDIAAGIRHLLDHQAPYGTYNLSNGGERQSWAGVARDVYRLSGADPERVT
PISTADYMGPGTAPRPRSSVLDLSKIRATGFDPPAATQRLAEFLRSLQL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccgggagagcaactgcactcgaggaccacgcccattccaggcttgctgctgttt
gaactggcagttcatggtgatgaacgaggctggttcaaggagaactggcaccgggccaag
atgcgggacataggcctcccggacttcgggccggtgcaaaacaatatctccttcaacgca
gcacgcggaacgattcgtgggtttcatgccgagccatgggacaagttcgtgtccttggcc
tccggccgcatcttcggcgcctgggtagacctccgcgaaggtccaacgttcgggacctcg
ttctgcgctgaactgactgcccacgacgccgtgtttgtcccgcggggcgtaggcaacgcg
ttccagactctggaagacgacaccgcctatacgtacttggtcaacgaccattggagcgcg
gaggcgcagagggactacaccttcctcaaccttgccgacgaacacgtcgccgtgccctgg
ccgattcccttgaagagcgccattctgtctccacaggacaagaagcatccgcgcctcgcg
gacgttgttcccatgccggggcgccgcacgctggtccttggagctgagggccagttaggc
acagcactccggcacgccttcgaaggggacgccacggtggagttcgctggccgcgcgcaa
ttcgacatcacctctgaggcctcctaccgcgccgtcaactggcgctcttactccgcggtt
atcaacgccgccgcgttcacggcggtggatgccgccgaaactccggaaggtcgcgcagct
gcctggaacatcaacgcaactgctgtttcccgcttggcgcgtgccgccgtcgagcattca
ctgacattggtccatgtatccagtgactacgttttcgacggcacagcagaggtccacttc
gaagatgagatgcccactcccctgggagtctacggtcagagtaaggccgcaggtgacgcg
gcggtagcggcagtgcagaagcactacatcgtcaggacaagttgggttgtgggcgagggg
agaaactttgttcgaaccatggcatcgttggcggccaagggcgcctcgccatcggtagtg
gatgaccaatgggggcggttgagcttcgcaaaagacatcgctgcgggaattcggcacctg
cttgatcatcaagccccttacggaacttacaacctcagtaatggcggggagcggcagtcc
tgggccggagttgccagggacgtgtacaggttgagtggagcggacccggaacgggtgacg
cccatcagcaccgcggactacatggggccgggaactgcgccgcgcccccgcagcagcgtc
ctggacttatccaagatccgtgccaccggctttgatcccccggcggcaactcagcgcctc
gctgagttcctcaggagcctgcagctctag

DBGET integrated database retrieval system