KEGG   Arthrobacter aurescens: AAur_2247Help
Entry
AAur_2247         CDS       T00447                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aau  Arthrobacter aurescens
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aau00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2473892..2475406)
Genome map
AA seq 504 aa AA seqDB search
MNQYVIAIDQGTTSSRAIVFDHAGNIVSTGQMEHEQIFPQAGWVEHNPAEIWNNTREVIG
SALSKANLTRHDIAAVGITNQRETAVVWDKNTGEAVYNAIVWQDTRTQSIVDELAQDGGP
ERFKQKVGLPLATYFSGTKIKWILDNVDGARERAEAGDLLFGNTDAWVLWNLTGGVDGGV
HVTDVTNASRTLFMDLETLQWDQEILDIFGVPASMMPAIKSSSEVYGHVHTSQLLRETPV
AGILGDQQAATFGQAAFQPGEAKNTYGTGCFLIFNTGEEIVHSKNGLLTTLGYKLGDAKP
HYALEGSIAVTGSLIQWLRDNLGMISSAPEVEELAAGVRDNGGVYIVPAFSGLFAPYWRA
DARGAIVGLTRFANKGHIARAALEATAFQTREVLDAVNADSGVPLTELKVDGGMVANEAL
MQFQADILGVPVVRPKVVETTALGAAYAAGLAVGFWKDLGELSANWNEDKRWEPQLPAEE
QERQLRLWKKAVTKSMDWVDEDVK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatacgtcatcgccatcgaccaaggcaccaccagctcgcgcgccattgttttc
gatcacgcgggcaacatcgtgtccaccggccagatggaacacgagcagatcttcccgcag
gcaggatgggtggagcacaaccccgccgagatctggaacaacacccgtgaggtcatcggc
tcggccctgtcgaaggccaacctgacacggcacgacattgccgccgtcggaatcaccaac
cagcgcgaaacagctgtcgtctgggacaagaacaccggcgaggccgtctacaacgcgatc
gtttggcaagacacccgcacccagtcaatcgtcgatgagctggcccaggacggtggaccg
gagcgcttcaaacagaaggtcggcctgcccctggccacctacttctccggcaccaagatc
aaatggatcctggacaacgttgacggcgcccgcgaacgcgcagaagccggcgacctcctg
ttcggcaacaccgacgcctgggttctgtggaacctgaccggcggcgttgacggcggcgtg
cacgtcaccgacgtcaccaacgcatcccgcaccctgttcatggacctcgagaccctgcag
tgggaccaggaaatcctggacatcttcggcgtaccggcctccatgatgcccgccatcaag
tcctcctccgaggtctacggccatgtccacacgtcacagctgctccgggaaacgcctgtt
gccggcatcctcggtgaccagcaggcggcaaccttcggccaggccgcgttccagcccggc
gaagccaaaaacacctacggaaccggctgtttcctgatcttcaacaccggcgaggaaatc
gttcactccaagaacggactcctcaccaccctcggatacaagctgggcgacgccaagccg
cactacgcccttgaaggctccatcgccgtcaccgggtccctgatccagtggctccgcgac
aacctcggcatgatcagctcggcccctgaagtggaggaactggccgcgggtgttagggac
aacggtggcgtctacatcgtccccgccttctcaggcctgttcgccccctactggcgggca
gacgcacgcggtgccatcgtgggcctcacgcgtttcgccaacaagggccacatcgcccgc
gcggcactggaagctaccgccttccagacccgcgaggtactcgacgccgtcaacgcagac
tcgggtgttccgctcaccgagctgaaggtcgacggcggcatggtcgccaacgaggcactc
atgcagttccaggcagacatcctgggcgtacctgtagtccgcccgaaggttgtggaaacc
acggccctcggtgcagcctatgcagctggcctggccgtcggattctggaaagacctgggc
gagctcagcgccaactggaacgaagacaagcgctgggagccccagctcccggcagaggag
caggagcgtcagcttcgactctggaagaaggccgtgacaaagtccatggattgggtcgac
gaagacgtgaagtag

DBGET integrated database retrieval system