KEGG   Arthrobacter aurescens: AAur_2469Help
Entry
AAur_2469         CDS       T00447                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
aau  Arthrobacter aurescens
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aau03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2713246..2714208)
Genome map
AA seq 320 aa AA seqDB search
MPELPEVEVVRRGLARWVRGRTVTGVDVLDPRSIRRHALGTEDFIGNLEHATVLDVVRRG
KFLWMPLVMSGVSDTEPADELPKVALMAHLGMSGQLLMQDPVVPDEKHLKVRISLSPADG
MPEQLRFVDQRIFGGLFVTALVPTVDGGPGGLGETPLPEIAEEASHIARDPLDPYFSFDA
FYRKVKGRKTGLKRALLDQGVISGIGNIYADEALWRARLHYARATDTLRRADAERLVEAV
KDVMNAALAAGGTSFDSLYVNVNGDSGYFARSLNAYGRAGELCGRCEAIGLHSVMKREQF
MNRSSYTCPVCQPRPRNGRW
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacttcctgaagtagaggttgtccgccgcggcttggcccggtgggttcgtggc
cgtaccgtcaccggtgttgatgtccttgatccgcgctccatccgacgccatgccctcgga
acagaagactttatcgggaatcttgagcacgcaaccgtgctggacgtcgtccgtcgaggc
aagttcctctggatgcccctcgtcatgtccggcgtatccgacaccgaacccgcggacgag
ctccccaaggtggcgctgatggcgcatctgggaatgagcgggcagctgctgatgcaggac
cccgtggtgccggatgagaagcacctgaaggtcagaatcagcctcagcccggcggacggg
atgcctgagcagctgcggttcgtggaccagaggatttttggtggcctgttcgtgactgct
ttggtgccaactgtcgacggtggccctggcggcctgggcgaaacgcccctgccggagatc
gccgaggaagcatcgcacattgcccgggacccgcttgacccttacttctcttttgacgcg
ttctaccggaaggtcaagggccgcaagaccggcctgaagcgcgctcttctggaccaaggg
gtcatttccggcatcggcaacatctatgcagatgaagccttgtggcgtgcccgtctccac
tatgccagggccacagacacacttcgccgggcggatgccgagcgcctggttgaggctgtg
aaagacgtcatgaacgccgcccttgccgcaggggggacgagttttgactccctctatgtg
aatgtcaatggcgattccgggtacttcgccaggtcgctcaatgcctacggacgtgccggt
gaactgtgtggccgttgcgaggcaatcggattgcacagcgtcatgaagcgggaacagttt
atgaaccgttcttcctatacctgcccggtgtgccaaccgcggccgcggaatggacgttgg
tag

DBGET integrated database retrieval system