KEGG   Arthrobacter aurescens: AAur_2576Help
Entry
AAur_2576         CDS       T00447                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
aau  Arthrobacter aurescens
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AAur_2576
Enzymes [BR:aau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     AAur_2576
    3.5.1.-  
     AAur_2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2826201..2826827
Genome map
AA seq 208 aa AA seqDB search
MSRALIIVDVQNDFCEGGTLAVEGGAAVAGAITEYVDANQQHFDHIVATQDWHIEPGEHF
SDDPDMVDSWPPHCRARSKGAELHEDLDPEYIQAYFRKGQFTAAYSGFEGVLAPEDDVPT
GDLKAGTTVTEVLDEDAIGLDDWLQSHDVEEVVVVGLATDYCVKATALDAMQAGYTTTVI
AELTAGIAKDLTDAYDEMEAAGVEVERD
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtccagggccctgatcatcgtcgatgtacaaaatgacttctgcgaaggcggaacgctc
gccgtcgaagggggagccgcggtagccggtgccatcacggagtatgtagacgccaaccag
caacacttcgatcacatcgttgccacccaggactggcacatcgagcccggcgagcacttt
tcggatgacccggacatggttgattcctggcctccgcactgcagggccaggagcaaaggt
gccgaactccacgaagaccttgatcccgagtacatccaggcctacttccgcaaagggcag
ttcaccgctgcctactccggattcgagggcgtcctggctcctgaggacgatgtccccacc
ggggaccttaaagcaggcaccaccgtaactgaggtcctcgatgaagacgcgatcgggctt
gacgactggctgcaaagccacgacgtcgaggaagtggtggtagtggggctcgcaacggac
tactgcgtcaaggccacggcactggatgctatgcaggccggttacaccaccacggtcatc
gctgaactcacggccggaatcgccaaagacctcaccgacgcctacgacgaaatggaagcc
gccggcgtcgaggttgaacgcgactga

DBGET integrated database retrieval system