KEGG   Arthrobacter aurescens: AAur_2611Help
Entry
AAur_2611         CDS       T00447                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aau  Arthrobacter aurescens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AAur_2611 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AAur_2611 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AAur_2611 (thrC)
Enzymes [BR:aau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AAur_2611 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2864179..2865282)
Genome map
AA seq 367 aa AA seqDB search
MAHQWRGVIREYADRLPVTEATKVITLGEGGTPLVHAQKLSELTGSEVYLKVEGMNPTGS
FKDRGMTMAMTAAVEAGAKAVVCASTGNTSASAAAYATAAGLKCAVLVPEGKISMGKLSQ
AIAHGATLLQVDGNFDNCLDIARKLGEAYPVFLVNSVNPARIQGQKTGAFEVVDTLGDAP
DIHVLPVGNAGNISAYWKGYKEYSAPFETTNGTLPAVSTKTPVMWGFQAAGAAPFVAGHP
ITEPDTIATAIRIGNPASWETAVAARDESGGLIEAVTDDEILAAHRWLSAKEGVFVEPGS
AAGVAGLIKKHAAGEVPSGKTIVITVTGHGLKDPQWALRTEDGSDVQPVKVPNDVVTVAA
ELGLEEN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaccaatggcgcggagtaatccgcgaatacgctgatcgtttgcctgtaacggaa
gccaccaaggtcatcaccctgggagagggcggcactccgctcgtccacgcgcagaagctt
tccgagctgaccggctcagaggtgtacctgaaggtcgaaggcatgaaccccacgggttcc
ttcaaggaccgcggcatgaccatggccatgacggctgccgttgaagccggtgcaaaggct
gttgtttgcgcttccaccggcaacacctccgcctcggctgcggcctacgccactgcggca
ggcctcaagtgcgctgtgcttgtacccgaaggcaagatctccatgggcaagctgagccag
gccatcgcgcacggcgccacactgctccaggttgacggcaactttgataactgcctggac
atcgcccggaagctcggcgaggcctacccggtgttcctggtgaactcggtcaacccggcc
cgtatccagggccagaagaccggtgccttcgaagtggtggacaccttgggcgatgcccct
gacatccacgtactgcctgtaggcaacgccggcaacatcagtgcttactggaagggctac
aaggaatactccgcgcccttcgagaccactaatggaacacttcctgctgtttccaccaag
acgcccgtcatgtggggcttccaggccgccggtgccgcgccgttcgttgcaggccacccc
atcaccgagcccgacacgattgccaccgccatccgcatcggcaacccggcctcgtgggaa
accgcagttgcggcccgtgacgaatccggtggactgatcgaggctgtcaccgatgacgag
attctggctgctcaccgctggctttcggcaaaggaaggcgttttcgttgaacccggctcc
gctgccggtgtcgcgggcttgatcaagaagcatgccgccggcgaggttccgtcgggcaaa
accatcgtcatcacggttactggacacggactcaaggacccgcagtgggccctccgcacc
gaagacggcagcgacgtgcagcccgtcaaggtgccgaacgacgtcgtcactgttgccgca
gaactgggactggaagaaaactaa

DBGET integrated database retrieval system