KEGG   Paenarthrobacter aurescens: AAur_2789Help
Entry
AAur_2789         CDS       T00447                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00300  Lysine biosynthesis
aau01100  Metabolic pathways
aau01120  Microbial metabolism in diverse environments
aau01230  Biosynthesis of amino acids
Module
aau_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    AAur_2789 (dapE)
Enzymes [BR:aau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     AAur_2789 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABM07087
UniProt: A1R8D9
Position
complement(3068794..3069918)
Genome map
AA seq 374 aa AA seqDB search
MTLNPAPALLDLRQDVAVLTAALIDFNSVSGNETELADAVESALRAIPAYTVTRDGDAII
ARTELGRSERVILAGHLDTVPLPTVEGSLGTVPATWESGVPGEGILYGRGTTDMKGGVAV
QLALAATLFDDGRQPDKDVTFVFYDHEEVEAVKSGLGRLVRNHGDLLQGDFAILLEPTHG
TVEGGCNGTSRFEATTIGETAHSARAWMGVNAIHAAAPILARLAAYEPQTINVDGLDYRE
SLNAVKINGGTAGNVIPDRCVVEINYRFAPDKNPDQAEAIVRDLLEGFDVVRTDAAAGAR
PGLNHPAAASFVAAVGAEPKPKYGWTDVARFSELGIPAVNFGPGDPLLAHKDNEHVDADA
IRECLRALRTWLAP
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgaaccctgctcccgccctccttgacctgcgccaggacgttgccgtgctgaca
gccgcgctcattgacttcaacagcgtgtccggcaacgagaccgaactcgccgacgccgtc
gagtccgcccttcgtgccatcccggcctataccgtgacccgtgacggcgacgccatcatt
gcgcgcaccgaacttggccgttccgagcgcgtcatcctggccggacatctggacaccgtg
ccccttcccaccgtggagggctcactgggcaccgttccggccacgtgggagtccggggtt
cccggtgaaggcatcctgtacgggcgcgggaccacagacatgaagggtggcgtggcggtg
cagctcgccctcgcggcaacactgttcgacgacgggcggcagccggacaaggacgtcacc
ttcgtcttctacgaccatgaggaagtggaagcggtcaagagcggcctcggaaggttggtc
cgcaaccacggtgacctgttgcagggcgacttcgcgatcctgctggagccaacccacggc
acggtggaaggcggctgcaacggcaccagccgcttcgaagccacaaccatcggcgaaaca
gcccactctgcacgcgcatggatgggcgtcaacgcgatccacgccgcagcacccatcctg
gcgcggctcgctgcatacgagccgcagaccatcaacgtggacggccttgattaccgcgaa
agcctcaacgccgtgaaaatcaacgggggcacggcagggaacgtcatcccggaccgctgc
gtggtggagatcaactaccgtttcgctccggacaagaatccggaccaggcagaggccatc
gtcagggaccttctggaaggattcgacgtcgtccgtacggacgctgctgccggcgcgagg
cccggacttaatcaccccgccgccgcgtccttcgtcgccgcagtgggtgccgagcccaaa
cccaaatacggatggaccgacgtcgcgcgtttcagtgaactgggcatcccggcagtgaac
ttcggacccggcgatccgctgctggctcacaaggacaacgagcacgtcgacgccgatgcc
atccgtgagtgcctccgtgcactgaggacgtggctggcgccgtag

DBGET integrated database retrieval system