KEGG   Arthrobacter aurescens: AAur_2821Help
Entry
AAur_2821         CDS       T00447                                 

Gene name
bgaC
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
aau  Arthrobacter aurescens
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aau00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3102381..3104177)
Genome map
AA seq 598 aa AA seqDB search
MNNALLSYHDAVLYRSGEPYRILAGAIHYFRVHPDLWQDRLRRLKAMGANTVDTYVAWNF
HQPKRDEAPDFSGWRDLGRFMDLAAEEGLDVIVRPGPYICAEWDNGGFPSCLTGIPGIGL
RCMDPVFTAAIEEWFDHLLPIVASRQTSAGGPVVAVQIENEYGSYGDDHEYIRWNRRALE
ERGITELLFTADGGTDYFLDGGAVEGTWATATLGSRGDEAVATWQRRRPGEPFFNVEFWG
GWFDHWGEHHHGRDAEDAALEARKMLDLGGSLCAYMAHGGTNFGLRSGSNHDGTMLQPTV
TSYDSDAPIAENGALTPKFHAFRKEFYRAQGVDDLPELPAALLADAPVLPAQSLPLSPGP
ELLELVRDAGKPVSSVKPLSFEQLGLDGGMVLYSSEAILPGRPDAPTESRLKITGLNDRA
YVWVDGTFAGVLDDVNGSEGLPVTGTGIAAKLEILVENLGRINYGPLTGHGKGILGGVLV
NQRYTFHWRQTPVDLAEWGPEDLEGLAGSDFEVGEPADTFIALPDSGKGFVWLNGFLLGR
YWEKGPQVTLYAPAPLLKAGRNSIKVLELGKPGTVVELREAPDLGPEEAGPIKAAELP
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaacgccctgctgagctaccacgacgccgtcctttaccgttcgggtgaaccgtat
cgcatcctcgccggagccatccactacttccgtgtgcacccggacctgtggcaggaccgg
ctgcgtcggctcaaggcgatgggcgccaacacggtggacacgtacgttgcttggaacttc
caccagcctaagcgcgacgaagctccggacttcagcggctggcgggacttgggccggttc
atggacctcgcagcagaggaagggctggacgtcatcgtccgccccgggccctacatttgt
gccgagtgggacaacggcggcttcccctcatgtctgacaggcattcccggcatcggcctt
cggtgcatggacccggtgttcaccgctgccatcgaggagtggttcgatcacttgcttccc
atcgtcgcctcacggcagacctccgcgggtggtccggtggtggcggtgcaaatcgagaac
gaatacggcagctacggcgacgaccacgagtacattcgctggaaccggcgcgcgctggag
gagcgcggtatcactgaactccttttcacagcagacggcggcacggactacttcctcgac
ggcggcgcggtggaaggcacgtgggcgacagcgacgttgggaagccgcggcgacgaagcg
gtagctacatggcagcgacgccggcccggcgagccgttcttcaacgttgagttttggggt
ggctggttcgaccactggggcgaacaccatcacgggcgggatgcagaagacgccgcattg
gaagcacgcaagatgctggatctgggcggttcactctgtgcctacatggcccacggcgga
accaactttggcctccgctccggcagtaaccacgatggcaccatgcttcagcccacggtc
accagctatgactcggatgcacccatcgctgagaacggcgccctgactcccaagtttcat
gccttccgtaaggagttctaccgggcacagggcgttgacgacctgcccgaacttccagct
gccttgctggcagacgcgccggtactcccggcgcagtccctgccgttgagccccggaccg
gagctgctggagctcgtcagagacgccggcaagccggtcagcagcgtcaaaccgctcagt
ttcgaacaactgggactcgacggcggcatggtcctctactcctccgaagccatactgccg
ggccgtcccgatgcccccacagagagccggttgaagatcaccggcctcaatgatcgtgcc
tacgtttgggtggacggcacctttgccggtgtcctggacgacgtcaacggctctgaagga
ctgcctgtcacgggcaccggcatcgctgccaagctcgaaatcctcgtggaaaacctcggc
cgcatcaattacggcccgctgaccggtcacggcaagggaatcctgggcggcgtcctcgtc
aatcagcgctacaccttccactggaggcagacacctgttgacctcgcagagtggggtccg
gaagacctggagggactggcaggaagtgactttgaggtgggggaaccagccgacaccttc
attgccttgcccgattccgggaagggcttcgtttggctgaacggcttccttttgggcagg
tactgggagaagggcccgcaggttaccctctacgcacccgctccgttgctcaaagccggc
cgcaacagcatcaaggtgctggaactcgggaagccggggaccgtcgtcgaacttcgcgag
gcgcctgacctaggtcccgaagaagcgggtccgatcaaggcggccgaacttccgtaa

DBGET integrated database retrieval system