KEGG   Arthrobacter aurescens: AAur_3063Help
Entry
AAur_3063         CDS       T00447                                 

Gene name
adhA
Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aau  Arthrobacter aurescens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AAur_3063 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_3063 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    AAur_3063 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AAur_3063 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AAur_3063 (adhA)
   00626 Naphthalene degradation
    AAur_3063 (adhA)
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AAur_3063 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3341947..3342969)
Genome map
AA seq 340 aa AA seqDB search
MSTTMQAAVVTEFGTDLTVKEVERPTPGPGQALVRLITSGVCHTDLHAAEGDWPVKPTPP
FIPGHEGVGEVVALGEGVTDVAVGDLVGNAWLWSTCGDCQYCRTGWETLCESQQNGGYSV
DGSFGEYMLVDTRFAARIPEGSDPVEVAPVLCAGVTVYKGLKMTEARPGQWVTISGIGGL
GHIAVQYAVAMGLRVAAVDIADDKLALAKEHGAELTVNALHEDPVEVIQRETGGCHGVLV
TAVHPSAFGQAIGMARRGGTIVFNGLPPGDFPAPIFEIVLKGLTVRGSIVGTRQDLEEAL
EFYAQGKIKPTVSTRELSEVNAVLDEMKHAKIDGRVVLKF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaaccatgcaagctgcagtagttacggaattcggaaccgaccttacggtcaag
gaagtggaaaggccgacgccgggtcccggccaggcgctggtccgcctcatcacctccggg
gtatgtcataccgacctccatgccgccgaaggcgactggccggtcaagcccacgccgcct
ttcattcccggacacgaaggtgtcggtgaagtggtcgccctcggtgagggcgtcacggac
gttgccgtgggcgatcttgtgggaaacgcctggctgtggtccacctgcggagactgccag
tactgccgtactggttgggaaaccctgtgcgagtctcagcagaacggtggttacagcgtt
gacggctcgttcggcgagtacatgctggttgacacgcgctttgctgcccgcatcccggaa
ggctcggacccggtggaagtcgcgccggttctgtgtgccggggtcacggtctacaaggga
ctgaagatgaccgaggccaggcccggtcagtgggtcacgatctccggcatcgggggactg
gggcacatcgccgtgcagtatgccgtggcaatgggtctgcgcgtggcggcagtggacatt
gccgacgacaagctggcgttggccaaggaacacggcgcggaactgacggtcaacgccttg
catgaggacccggtggaggtcatccaacgtgaaacaggcggctgccacggtgtcttggtg
accgctgtccacccctcggctttcgggcaggcgatcggcatggcgcgccgcggcggaacc
atcgtgttcaacggtttgcccccgggagactttcccgcgccgattttcgagatcgtcctc
aagggccttacggtccgcggctcgatcgtgggaacgcggcaggacctcgaggaagcactg
gagttctacgcccagggaaagatcaagccgacggtctctacccgtgagctctccgaagtc
aacgcggtccttgacgagatgaagcacgccaagatcgacggccgagtggtcctgaagttc
tga

DBGET integrated database retrieval system