KEGG   Arthrobacter aurescens: AAur_3154Help
Entry
AAur_3154         CDS       T00447                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2 (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aau  Arthrobacter aurescens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AAur_3154
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_3154
   00020 Citrate cycle (TCA cycle)
    AAur_3154
   00620 Pyruvate metabolism
    AAur_3154
Enzymes [BR:aau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AAur_3154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3454359..3455840)
Genome map
AA seq 493 aa AA seqDB search
MSSDMQVFKLPDLGEGLTEAELVNWLVAVGDEIVVDQPIAEVETAKSMVEVPSPYAGTVA
ELHGEAGQTLDVGKPLISIARAGSAAGSPAAAPVPAPAGSVDPSPVSSGLDVSSAVEAAA
ETYRTEEKAGSGNVLIGYGTPGGATGGRTRPRKASASVVASAVAEPAAVPEMEPAVAGTR
IPGKLSAVISPLVRKMARDHGVSLDAIEGSGASGLIMRRDVEAVIASPSVAAEPSVAAIP
AAPLSAPASAGAVDSRTGLSVSARTPVRGVRKAVAANMTRSRSEIPEATVWVDVDATALL
DMRAELKKRAPYDTPGLLAFIARFVTAGLKKYPALNTRFETASDGSQEIVGFEGINLGFA
AQTDRGLVVPSVRNAHELSARELDAEIRRLTAVARDGKATPTELGSGTFTLNNYGVFGVD
GSAAIINYPEVAMLGVGRIIDKPWVVNGELAVRKVTELTLAFDHRVCDGETAAGFLRYVA
DAIENPGGALADM
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagatatgcaggtcttcaaactgcccgatcttggggagggcctcaccgaggcc
gaactggtgaactggctcgtcgccgtgggtgacgagattgtggttgaccagcccattgcc
gaggttgagaccgccaagtccatggttgaggtgccctcgccttacgccggcaccgtcgcc
gagttgcacggtgaagccggtcaaacgctcgacgtcggcaagccgctgatctcgatcgct
cgcgctggttccgccgccggttcgcccgctgccgctcctgttcctgctccggctggttct
gtggacccatcgccggtgtcctcgggtcttgacgtttcgtccgccgtggaagctgctgcc
gagacgtaccggaccgaggaaaaggcaggctcgggcaatgtgctgattggttacggtacg
cccgggggagccaccggtggccggacccggccgcggaaggcgagtgcttctgttgttgct
tctgctgttgctgagcctgctgctgtgccagagatggagccggctgtggccggaacgcgc
atcccgggcaagctcagtgccgtcatctctccgcttgtccgcaaaatggcacgcgaccac
ggtgtttccctcgacgctattgagggctcgggcgccagcggactgatcatgcgcagggac
gtggaggctgttattgcttcgccctcggttgctgctgagccttctgttgctgccattcct
gctgctcccctttctgctcctgcttctgcgggtgccgttgatagccgtaccggtttgtct
gtctccgcccgcacacctgtccgtggagtccgcaaggccgtggccgcgaacatgacccgc
agccgctcggaaatccctgaagccaccgtttgggtggatgtggacgcaacagcgctgctg
gatatgcgggccgagctcaagaagcgcgcaccatacgacacccctggtctgttggccttc
attgcccgttttgtcacggctgggttaaaaaagtacccggccttgaacacgcgctttgaa
accgcttcggatggctcgcaggagatcgtcgggtttgaaggaatcaacctcggcttcgcc
gcccaaaccgaccgcggactcgtagtcccgtccgtgcggaatgcgcatgagctgagtgcc
cgcgaactggacgcagagatccgccgactcaccgccgtcgcacgtgacggaaaggcgacc
cccacggaactgggctcgggcacgttcacgctgaacaactacggtgtgttcggcgtggac
ggctcggccgcgatcatcaactatcccgaggtcgcgatgctgggcgtgggccgcatcatc
gacaagccctgggtagtcaacggcgagcttgccgttcgcaaggtcaccgagctgaccctc
gccttcgaccaccgcgtgtgcgacggcgaaaccgcggccggcttcctccggtacgttgcc
gacgcgatcgagaaccctggcggcgcgctcgcagacatgtaa

DBGET integrated database retrieval system