KEGG   Arthrobacter aurescens: AAur_3362Help
Entry
AAur_3362         CDS       T00447                                 

Gene name
rafA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aau  Arthrobacter aurescens
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AAur_3362 (rafA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    AAur_3362 (rafA)
   00600 Sphingolipid metabolism
    AAur_3362 (rafA)
Enzymes [BR:aau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AAur_3362 (rafA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3697345..3699516
Genome map
AA seq 723 aa AA seqDB search
MHPLHLRSAGTSLVISTHRGEAEITHWGADLGDTLPDLALLNEPIPPSSIDANVPAGLLP
QASSSWQGRPGLRGHRFTDGVPGFDFSVRLRVVSATSDGTTAVIVQADPDAGITVTSNLS
LHPGGLLEVKHSATNHGTSPFQVDELATMLPVAPDAVELLDLTGRWCRERHPQRRAIQQG
TWVRTGRHGRTGHDSSLLLAAGTAGFGNRHGKVWATHLAWSGNHEQFADNVTDGRTMVGG
SELLGPAEVVLQPGESYTTPALFAAYSDRGLDGISEAFYSWFRSRPHHVGASSGKARPVV
LNTWEAVYFDHKLDTLIELAESAADLGVERFVLDDGWFRGRRGDHAGLGDWYVDETLWPS
GLTPLIDAVTSRGMEFGLWVEPEMVNLDSDIARAHPEWIVGPSAVSYKDGGRLPLGWRQQ
HVIDLVNPDAWQYIYDRIDALLRENNISYLKWDQNRDLLEHGHAGQASVHEQTLAAYRLF
DALHAAHPGVEIESCSSGGARVDLGILERTDRIWASDCNDALERQTIQRWTGMVVPPELV
GGHIGPTTSHTTGRTHDLSFRAITALFGHFGMEWDVRSVTEEEREELKRFIGLYKEHRGL
IHSGRMVRADVPDESLMVHGVVADAPTSGATAALFAVVKTRTGFSELPGRVTIPGLDPCR
TYRVESIFPAPGDADYGHTFTEAKPAPWVDSGAAASGRFLGEVGLPMPVLNPEHAILLRF
TAL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgctccatctccgttccgcaggtaccagcctggtgatcagcacccaccgtgga
gaggctgagataacgcactggggagccgatctgggcgacaccctcccggacttggccctc
ctcaacgagccaatcccgccttcgtccattgacgcgaacgtccccgcgggcctccttccc
caggcgtcgtcgtcgtggcagggccggccgggacttcgaggccaccgcttcacggacggc
gtgcccggttttgatttctcggtgcgcctgcgcgtcgtgagtgcgacgtcggacggcacc
acagcggtgattgtccaggccgatcccgacgccggcatcaccgtcaccagcaacctcagc
ttgcacccgggcggcctcctcgaagtgaagcactccgcaaccaaccatggcacgtcgcct
ttccaggtggacgagttggcgaccatgctcccggtggcgccggacgccgtcgaacttctg
gacctgacgggtcgttggtgccgtgagcgccacccccagcgcagggccattcaacaggga
acctgggtccgcacgggccgccatggacggaccggacatgactcctcgctcctgcttgcg
gccggaacagccggcttcggcaacaggcacggcaaggtctgggcgacgcacttggcgtgg
agcggcaaccacgagcagttcgcggacaacgttaccgatggccgcaccatggtgggtggc
tccgagctgttgggacccgccgaagtggtcctgcagcccggcgaaagttacacaactccc
gcactgtttgcggcctactcagaccggggactggacggaatttccgaggctttctactcc
tggttccgttcacggccgcaccacgtgggtgcatcttccggtaaagcccgcccagtagtc
ctcaacacgtgggaagcggtgtatttcgaccacaaactggacaccctgatcgagttggcg
gagtcggctgccgatcttggagttgaacgtttcgtgctcgacgacggctggttccgcggg
cgccgcggcgaccacgcggggctgggcgactggtacgttgacgagaccctctggccgagc
ggcctgactccgttgattgatgccgtgacgtcacgcggcatggagttcgggctgtgggtg
gagccggaaatggtcaatctggactccgacatcgccagggctcatcccgaatggatcgtg
ggcccctcagcggtttcctacaaagacggcggccgcctgcccctcgggtggcggcagcag
catgtgatcgacctcgtgaacccggatgcgtggcagtacatttacgatcggatcgacgcc
ctgctgcgtgagaacaacatcagctacctcaagtgggaccagaaccgcgacctgctggag
cacgggcatgcgggccaggcttcggtgcacgagcaaacccttgccgcgtaccggctgttc
gatgcgctccatgcagcccacccaggggttgagatcgaaagctgctcctccggtggcgcc
cgtgtggaccttgggatcctggagcggacggaccggatctgggcttccgactgcaacgac
gccttggaacggcaaaccatccaacgatggaccggaatggtggtcccgccggaactggtg
ggcggacacattggacccactacgtcgcacaccaccgggcggacgcacgacctctcgttc
cgcgccatcacggcgttgtttggacacttcggcatggagtgggatgtccgttccgtcacc
gaggaggagcgtgaggagctcaagcgcttcatcggactgtacaaggaacaccgtggcctt
attcacagtggccgaatggtgcgggccgatgtgccggacgagtccctgatggtgcacggc
gtggtggctgacgctccaacgtccggtgccacggctgctcttttcgccgtggtgaaaacc
cggacaggctttagcgaactacccggacgggtgaccattccggggttggatccgtgccgg
acctaccgggtggagtcgatcttccctgcccccggggacgccgactacgggcacacgttc
actgaggcaaagccggcgccgtgggtggattccggggctgcggcttcgggacggttcctg
ggtgaggtaggtcttcccatgccggtcctgaacccggagcatgccatcctgctgcggttt
acggccctctga

DBGET integrated database retrieval system