KEGG   Arthrobacter aurescens: AAur_3402Help
Entry
AAur_3402         CDS       T00447                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
aau  Arthrobacter aurescens
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AAur_3402
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    AAur_3402
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     AAur_3402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3747999..3748913
Genome map
AA seq 304 aa AA seqDB search
MTMSNNIVLGENQYGKAEVRVVKVTRDTDRHHIEDLNVTSQLRGDFQAAHLEGDNGHVVA
TDTQKNTVYAFAREGIGSPESFLLRLADHFTGGFDWVTGGRWEAEAYSWDRIQAHGEGHD
HSFVRNGQEVRTAVVVRDGATTHLISGLKDLTVLKTTQSGFVGYPRDKYTTLPETTDRIL
ATDVSARWRYNTNLDFAGTDFNKSYEDIKALLLEGFTENYSHALQQTLFDMGKKVLEAHS
EVDEIKFSMPNKHHFLVDLSPFGLDNPNEVFFAADRPYGLIEATVQRENIEAAPVAWSGI
AGFC
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgagcaacaacatcgtcctcggcgaaaaccagtacggcaaagcagaagtccgc
gtcgtcaaggtcacccgggatactgaccgccaccacatcgaagacttgaacgtcacctca
cagctgcgcggcgacttccaggcggcccacctcgaaggcgacaacggacacgtcgttgcc
accgacactcagaagaacacggtctacgcctttgcccgtgaaggcatcggctcacccgag
tccttcctgcttcgcctcgcagaccacttcactggcggattcgactgggtcaccggcggc
cgctgggaagccgaagcctacagctgggatcgcatccaggcccacggcgagggacacgac
cacagcttcgtccgcaacggacaagaggtgcgtaccgccgtcgtcgtccgtgatggcgca
accacacacctcatcagcggcctcaaggacctgaccgtcctgaagaccacgcagtccggt
tttgtcggctacccgcgcgacaagtacacaaccctgccggagaccaccgaccgcatcctg
gccaccgacgtatccgcccgctggcgctacaacaccaacttggacttcgccggcacggac
ttcaacaagagctacgaggacatcaaggcactcctgcttgaaggcttcaccgagaactac
tcccacgcactgcagcagacgctgttcgacatgggcaagaaggtcctggaagctcacagc
gaagtggacgagatcaagttctccatgcccaacaagcaccacttcctggttgacctgagc
ccgttcggcctggacaaccccaacgaggtcttcttcgccgcggatcgcccgtacggcctc
atcgaagcaaccgtccagcgcgagaacatcgaggctgcaccggtggcatggagcggcatc
gccggcttctgctaa

DBGET integrated database retrieval system