KEGG   Arthrobacter aurescens: AAur_3407Help
Entry
AAur_3407         CDS       T00447                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
aau  Arthrobacter aurescens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AAur_3407 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAur_3407 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    AAur_3407 (aceB)
Enzymes [BR:aau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AAur_3407 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3753679..3755277
Genome map
AA seq 532 aa AA seqDB search
MAITVTDPRPIDRAEEILTPKALAFIEELHKRFAGTRNELLEARQVKRQKVADTSRLDFL
PETQEIRDGDWKVAEAPAALQDRRVEMTGPATPAKMAINALNSGAKVWLADLEDASTPTW
PNVIDAILNLRDAAQGTLSYTSPEGKEYRLRTDAPLAVVVARPRGWHMEENHLLIDGEPA
VGALVDFGLHFFHIAKQLLLNGQGPYYYLPKMESHLEARLWNDVFVFAQDFLGIPQGSVR
ATVLIETIPAAFEMDEILYELRDHASGLNAGRWDYLFSIIKYFRDAGEEFVLPDRATVAM
TAPFMRAYTELLVKTCHKRGAFAMGGMAAVIPNRKQPDVTAAAFDKVRADKTREANDGFD
GSWVAHPDLVPTCREVFDSVLGDRPNQLDKQRPEVNVTAEQLIDVASAGGTVTEAGLRLN
LYVAVAYTGVWISGSGAVAIHNLMEDAATAEISRSQVWQQIRNKSVLADTGNTVTRELVT
RILGEETERLRIEFGDENFTKYYEPASKLIEDICLSDDYTDFLTTPAYELVG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctatcacagtcaccgatccccggccgatcgatcgcgccgaggaaatccttaccccc
aaggcactggccttcatcgaggaactgcacaagcgcttcgccggtacccgcaacgagctc
cttgaggcccggcaggtcaagcgccagaaggttgccgacaccagccggctggacttcctc
ccggagacccaggaaattcgcgacggcgactggaaggtcgccgaggcaccggcagctttg
caggaccgccgcgtcgagatgaccggcccggcaaccccggccaagatggccatcaacgcc
ctgaactccggcgccaaggtgtggctcgcggacctcgaagacgccagcactcccacctgg
cccaacgtcatcgacgccatcctgaaccttcgcgacgccgcccagggaaccctgagctac
acctcgcccgaaggcaaggaataccgcctccgcaccgacgctcccctggccgttgttgtg
gcccgcccgcgcggctggcacatggaggagaaccacctgctgatcgacggcgaacccgcc
gtgggtgcgctggtggacttcggcctgcacttcttccacatcgccaagcagcttctcctc
aacggccagggcccgtactactacctgcccaagatggagagccacctggaagcccgcctc
tggaacgacgtcttcgtgttcgcacaggacttcctgggcatcccgcaaggcagcgtccgc
gccaccgtgctcatcgaaaccatcccggcagcgttcgaaatggacgagatcctctacgaa
ctccgcgaccacgcctcgggcctgaacgccgggcgctgggactacctcttcagcatcatc
aagtacttccgtgatgccggtgaagagttcgtcctcccggaccgcgccactgttgccatg
acggcaccgttcatgcgggcctacaccgaactgctggtcaagacctgccacaagcgcggc
gccttcgccatgggtggcatggccgccgtcatccccaaccgcaagcagccggacgtcacc
gccgccgccttcgacaaggtccgtgccgacaagacccgcgaagcaaacgacggcttcgac
ggctcctgggttgcccacccggacctggtccccacctgccgcgaagtctttgactccgtg
ctcggtgaccgtcccaaccagctcgataagcaacgccccgaggtgaacgtcacggccgag
cagctcatcgacgtcgcctccgccggcggtaccgtgacggaggccggccttcggctgaac
ctgtacgtcgccgtcgcctacacgggcgtctggatctctggcagcggcgcagttgccatc
cacaacctcatggaagatgcagcgacagcggaaatctcccgctcgcaggtatggcagcag
atccgcaacaagtccgtcctcgcagacacgggcaacactgtgacccgcgaactcgtcacc
cgcatcctgggcgaagagaccgagcgcctgcgcatcgagttcggcgacgagaacttcaca
aagtactacgagccggcatccaagctgatcgaggacatctgtttgtccgacgattacacg
gacttcctcaccactcccgcgtacgagctggtgggctga

DBGET integrated database retrieval system