KEGG   Paenarthrobacter aurescens: AAur_3407Help
Entry
AAur_3407         CDS       T00447                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00620  Pyruvate metabolism
aau00630  Glyoxylate and dicarboxylate metabolism
aau01100  Metabolic pathways
aau01110  Biosynthesis of secondary metabolites
aau01120  Microbial metabolism in diverse environments
aau01200  Carbon metabolism
Module
aau_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAur_3407 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    AAur_3407 (aceB)
Enzymes [BR:aau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AAur_3407 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABM08114
UniProt: A1RA40
Position
3753679..3755277
Genome map
AA seq 532 aa AA seqDB search
MAITVTDPRPIDRAEEILTPKALAFIEELHKRFAGTRNELLEARQVKRQKVADTSRLDFL
PETQEIRDGDWKVAEAPAALQDRRVEMTGPATPAKMAINALNSGAKVWLADLEDASTPTW
PNVIDAILNLRDAAQGTLSYTSPEGKEYRLRTDAPLAVVVARPRGWHMEENHLLIDGEPA
VGALVDFGLHFFHIAKQLLLNGQGPYYYLPKMESHLEARLWNDVFVFAQDFLGIPQGSVR
ATVLIETIPAAFEMDEILYELRDHASGLNAGRWDYLFSIIKYFRDAGEEFVLPDRATVAM
TAPFMRAYTELLVKTCHKRGAFAMGGMAAVIPNRKQPDVTAAAFDKVRADKTREANDGFD
GSWVAHPDLVPTCREVFDSVLGDRPNQLDKQRPEVNVTAEQLIDVASAGGTVTEAGLRLN
LYVAVAYTGVWISGSGAVAIHNLMEDAATAEISRSQVWQQIRNKSVLADTGNTVTRELVT
RILGEETERLRIEFGDENFTKYYEPASKLIEDICLSDDYTDFLTTPAYELVG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctatcacagtcaccgatccccggccgatcgatcgcgccgaggaaatccttaccccc
aaggcactggccttcatcgaggaactgcacaagcgcttcgccggtacccgcaacgagctc
cttgaggcccggcaggtcaagcgccagaaggttgccgacaccagccggctggacttcctc
ccggagacccaggaaattcgcgacggcgactggaaggtcgccgaggcaccggcagctttg
caggaccgccgcgtcgagatgaccggcccggcaaccccggccaagatggccatcaacgcc
ctgaactccggcgccaaggtgtggctcgcggacctcgaagacgccagcactcccacctgg
cccaacgtcatcgacgccatcctgaaccttcgcgacgccgcccagggaaccctgagctac
acctcgcccgaaggcaaggaataccgcctccgcaccgacgctcccctggccgttgttgtg
gcccgcccgcgcggctggcacatggaggagaaccacctgctgatcgacggcgaacccgcc
gtgggtgcgctggtggacttcggcctgcacttcttccacatcgccaagcagcttctcctc
aacggccagggcccgtactactacctgcccaagatggagagccacctggaagcccgcctc
tggaacgacgtcttcgtgttcgcacaggacttcctgggcatcccgcaaggcagcgtccgc
gccaccgtgctcatcgaaaccatcccggcagcgttcgaaatggacgagatcctctacgaa
ctccgcgaccacgcctcgggcctgaacgccgggcgctgggactacctcttcagcatcatc
aagtacttccgtgatgccggtgaagagttcgtcctcccggaccgcgccactgttgccatg
acggcaccgttcatgcgggcctacaccgaactgctggtcaagacctgccacaagcgcggc
gccttcgccatgggtggcatggccgccgtcatccccaaccgcaagcagccggacgtcacc
gccgccgccttcgacaaggtccgtgccgacaagacccgcgaagcaaacgacggcttcgac
ggctcctgggttgcccacccggacctggtccccacctgccgcgaagtctttgactccgtg
ctcggtgaccgtcccaaccagctcgataagcaacgccccgaggtgaacgtcacggccgag
cagctcatcgacgtcgcctccgccggcggtaccgtgacggaggccggccttcggctgaac
ctgtacgtcgccgtcgcctacacgggcgtctggatctctggcagcggcgcagttgccatc
cacaacctcatggaagatgcagcgacagcggaaatctcccgctcgcaggtatggcagcag
atccgcaacaagtccgtcctcgcagacacgggcaacactgtgacccgcgaactcgtcacc
cgcatcctgggcgaagagaccgagcgcctgcgcatcgagttcggcgacgagaacttcaca
aagtactacgagccggcatccaagctgatcgaggacatctgtttgtccgacgattacacg
gacttcctcaccactcccgcgtacgagctggtgggctga

DBGET integrated database retrieval system