KEGG   Arthrobacter aurescens: AAur_3648Help
Entry
AAur_3648         CDS       T00447                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aau  Arthrobacter aurescens
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AAur_3648 (rbsK)
Enzymes [BR:aau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AAur_3648 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3999394..4000350
Genome map
AA seq 318 aa AA seqDB search
MTSEPKAGIVVVGSLNADLTIYCDRLPQPGETVHGNGFAVNPGGKSANQAVAASKLGGQV
SLIGAVGDDPNGSMLLESTASAGVDVSRVRRSDVATGVAVISVDAGGENSIIISAGANGT
LRPSDVTPDAFRDAAVVCLCLEVGIDTVITAAQAGHDAGATVLLNLSPYAEVPERLAGLS
DVLLVNAHEASLFLGAEADVPDADAEAEAWEPVRSQFADRGLQRVLVTLGSRGSVVLDSL
ARGTEDQITRIAPTRVSAVDTTGAGDAFTGAVAARLAAGESLADAASFASVAAALAATKK
GTQAAYPGIADVERLRGA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgaacccaaggcgggaatcgtcgtcgtcggctccctcaacgccgacctgacc
atctattgcgaccgcctcccccaacccggcgagacggtccacggcaacgggttcgccgta
aaccccggcgggaagagcgccaaccaggcggtggctgccagtaagctcggcggtcaggtc
agcctgatcggtgccgtgggtgacgaccccaacggcagcatgctcctggagtcgacagcc
agcgccggagtggacgtttcgcgcgtccgacgctccgacgtcgccacaggcgtcgcggtc
atttccgtggacgccggcggcgagaacagcatcatcatctcggccggcgccaatggcacc
ctcaggccttcggatgttacgccggacgccttccgggatgcggctgtggtgtgcctctgc
ctggaggtggggatcgatactgtgattaccgccgcccaagcagggcacgacgccggtgcg
acagttctgctcaacctctcgccttacgccgaggtgccggagcgcttggccgggttgagc
gatgtgctgctggtgaacgcgcacgaggcctcattattccttggtgcagaggccgacgtt
ccggacgccgacgcagaggctgaagcatgggagccggtccggagccagttcgcggaccgt
ggtctgcagcgggttctggtgaccctcggctcacggggttccgtagtactggattcgctg
gcccgtggtaccgaggatcagatcacccggatcgccccaacacgcgtttctgcggtggac
accacgggtgccggtgatgccttcactggtgctgtcgctgcgcgcctggccgctggcgaa
tcccttgcggatgccgcgtccttcgcctcggtggctgcggccttggctgccacgaagaaa
ggcacgcaggctgcgtacccgggcatcgccgacgtcgagcggctgcggggcgcttag

DBGET integrated database retrieval system