KEGG   Arthrobacter aurescens: AAur_3667Help
Entry
AAur_3667         CDS       T00447                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
aau  Arthrobacter aurescens
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aau00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:aau00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4019365..4020768)
Genome map
AA seq 467 aa AA seqDB search
MEQGKQNLSLRMIERLEAIFGRSIVKVGKPQMTHLRVEGGRTLSGEVDVNSSKNAGVALL
CASLINRGTTTLRRLARIEEVNRIVEVLTSIGMECTWLNGSDLRLRRPDALDLESMDVDA
ARRTRSVIMLLGPLLDETSEYLLPYAGGCDLGTRTVEPHMQALRQFGLEVEAKSGFYSVT
APPADGHDRSFVLTERGDTVTENAIMAAAHREGTTIIRNASPNYMVQDLCFYLQGLGVDI
DGVGTTTLKITGRSAIDVDIEYFPSEDPIEAMSLITAGIVTNSEVTIRRVPIEFMEIELA
TLEQMGQNLEISGEYMARNGRTRLVDVTTKPSELRAPQDKIHPMPFPGLNIDNLPFFAVI
AGNAEGQTMIHDWVYENRAIYLTELNKLGAQVQLLDPHRIYVNGPTKWRAAEIGCPPALR
PAACLLLAMLAARGTSELRNIYVIERGYEDLAERLNTIGAKIEYFQD
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggaacagggcaaacaaaacctgagcctccggatgatcgagcgcctcgaagccattttc
ggccgctcaatagtcaaggtcggtaagccccaaatgacacacctccgcgtggagggcggc
cggaccctctccggcgaagttgatgtcaacagcagcaagaacgccggtgtcgcgctcctg
tgtgcgagcctgatcaaccgtggaaccaccacgctgcgccgacttgcacggattgaggaa
gtcaacaggattgttgaggtcctgacgtccattggcatggaatgcacgtggctcaacgga
agcgacctccgtctgcgccgcccggacgccctggatctcgagtccatggacgtggacgcc
gcccggcgtacccgcagcgtcatcatgctgctcggtccgctcttggacgaaaccagcgaa
tacctgctgccctacgcgggtggctgcgatctcggaacgcgcacggtggagccgcacatg
caggctcttcgccagttcggccttgaagtggaggcgaagtccggcttctactccgtgact
gcgcctcccgctgatgggcacgaccggtccttcgtcctgaccgaacgcggcgacaccgtc
actgagaatgccatcatggccgctgctcaccgtgaaggcaccaccatcatccgcaatgcc
agccccaattacatggtgcaggatctctgcttctacctgcagggcctgggcgtggacatt
gacggcgtcggaaccaccacgctgaagatcaccggacgctcagccattgatgttgacatc
gagtacttcccgtccgaagaccccatcgaggcgatgagcctcatcactgcgggaatcgtg
accaactccgaggtcaccatccgcagggttcccatcgagttcatggaaattgaactcgcc
accctggaacagatgggccagaacctcgagatttccggcgaatacatggcacgcaacgga
cgtacccggctggtggacgtaacaaccaagccatccgagctgcgtgccccgcaggacaag
atccacccgatgccgttcccgggcctgaacatcgacaacctgcccttctttgcagtgatt
gcaggcaacgccgagggccagaccatgatccacgactgggtctatgagaaccgtgccatt
tacttgacggagctcaacaagctgggcgcccaagtgcagcttttggatccgcaccggatc
tacgtcaacgggcccaccaagtggcgtgcggcggaaatcggctgcccgcccgccctgcgt
cccgcggcctgcctgctcctggcaatgttggctgcccggggaacctccgagctccgcaac
atttacgtgatcgagcgcggctatgaggacctcgccgagcgcctgaacaccatcggtgcg
aagatcgagtacttccaggactga

DBGET integrated database retrieval system