KEGG   Arthrobacter aurescens: AAur_3716Help
Entry
AAur_3716         CDS       T00447                                 

Gene name
rhaD
Definition
short chain dehydrogenase (EC:1.1.1.1 4.1.2.19)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
K01629  
rhamnulose-1-phosphate aldolase [EC:4.1.2.19]
Organism
aau  Arthrobacter aurescens
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AAur_3716 (rhaD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_3716 (rhaD)
   00040 Pentose and glucuronate interconversions
    AAur_3716 (rhaD)
   00051 Fructose and mannose metabolism
    AAur_3716 (rhaD)
  Lipid metabolism
   00071 Fatty acid degradation
    AAur_3716 (rhaD)
  Amino acid metabolism
   00350 Tyrosine metabolism
    AAur_3716 (rhaD)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AAur_3716 (rhaD)
   00626 Naphthalene degradation
    AAur_3716 (rhaD)
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AAur_3716 (rhaD)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.19  rhamnulose-1-phosphate aldolase
     AAur_3716 (rhaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4072272..4074311
Genome map
AA seq 679 aa AA seqDB search
MTTNKTVEELISRSNRLGADKRNTNFAGGNTSAKGTEKDPVTGQDVELLWVKGSGGDLGT
LKAENLAVLRLDRLQALKDVYPGVEREDEMVAAFDYCLHGKGGAAPSIDTAMHGFVDAAH
VDHLHPDSGIAIATAVDGEALTSKVFGDKVVWVPWRRPGFQLGLDIAAIKEANPQAIGTI
LGGHGITAWGATSEEAEANSLWIIDQAENYIKDNGKAEPFGATLPGYSALPEAERRAKAA
ALAPVIRGLASTDKPQLGHFSDDAVVLEFLAAEEHPRLGALGTSCPDHFLRTKVKPLVLD
RPADASIEDSVARLKELHAAYREDYQAYYDRHADENSPALRGADPAIVLIPGVGMFSFGK
DKQTARVAGEFYINAINVMRGAEAISTYAPIEESEKFRIEYWALEEAKLARMPKPKSHAT
RIALVTGAASGIGKAIATRLASDGACVVIADLNLENAQKVAEELGGSDVAIGVQADVTDE
AQIAAAVQEAVLAFGGLDLVVNNAGLSISKPLLETTEKDWDLQHNVMAKGSFLVSKAAAK
VMIDQGMGGDIIYISSKNSVFAGPNNIAYSATKADQAHQVRLLAAELGEHGVRVNGINPD
GVVRGSGIFAGGWGAKRAAVYGVDEQELGKYYAQRTLLKREVLPEHVANAASVLTSNELS
HTTGLHIPVDAGVAAAFLR
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaataagactgttgaagaactgatcagccgttccaaccgcctcggtgcggat
aagcggaacaccaacttcgccggcggcaacacctccgcaaagggcaccgagaaggatccg
gtgacgggtcaggacgttgaactcctgtgggtcaagggctccggcggagacctcggcacg
ctgaaggctgagaaccttgcagtacttcggctggaccggctgcaggcactcaaggatgtt
taccccggcgtcgagcgtgaagacgaaatggtggccgcctttgattactgcctgcacgga
aagggcggcgctgcaccgtcgatcgataccgccatgcatggtttcgttgatgctgcccat
gttgaccacctgcacccggactcgggcatcgcgatcgccaccgcagtggacggcgaagcc
ctgacgtccaaggtcttcggcgacaaggtcgtgtgggttccgtggcgtcgccctggtttc
cagctgggcctggacatcgcggcgatcaaggaagccaacccgcaggccatcggcaccatt
ctgggcggccacggcatcaccgcgtggggcgccaccagcgaagaggccgaggccaactcg
ttgtggatcatcgatcaggccgagaactacatcaaggacaatggcaaggccgagcccttc
ggcgccacgcttcccggctacagcgccctccccgaggccgagcgcagagccaaggcggcc
gccctcgctcccgtgatccgcggcctggcgtccacggacaaaccgcagctggggcacttc
agcgatgacgccgtcgttcttgaattcctcgccgcggaagagcacccgcgcctcggtgcg
ctgggcacgtcctgcccggaccacttcctgcggaccaaggtcaagccgctggtcctggac
cggccggccgatgcctcgatcgaagactccgtggcccggctcaaggaactgcacgcggcc
taccgcgaggactaccaggcgtactatgaccgtcacgctgacgagaacagcccggccctc
cgtggcgcggacccggccatcgtgctgatccccggcgtgggcatgttctccttcggcaag
gacaagcagaccgcacgcgtggccggcgagttctacatcaacgccatcaacgtgatgcgc
ggcgcggaggcgatctccacgtacgccccgatcgaggaatccgagaaattccgcatcgag
tactgggctctggaggaagccaagctcgcccgcatgcccaagcccaagtcccacgccacc
cgcatcgcgctggtgaccggtgcggcgtccggcattggcaaggcgatcgccacccgtttg
gcgtccgacggcgcgtgcgtggtcattgccgacctgaaccttgagaatgcacagaaggtt
gccgaggaactgggcggttccgacgtcgccatcggcgtccaggcggacgtgaccgatgaa
gcgcagatcgctgccgcggttcaggaggccgtgctcgccttcggtggcctggaccttgtg
gtcaacaacgccggcctgtccatctccaagccgctgctggaaaccaccgagaaggactgg
gacctgcagcacaacgtcatggccaagggctcgttcctggtctccaaggccgcagccaag
gtcatgatcgatcagggcatgggcggagacatcatttacatctcctccaagaactccgtg
ttcgccggccccaacaacatcgcctactccgctaccaaggcagaccaggcccaccaagtg
cgactgctcgccgccgaactgggcgagcacggtgtccgcgtcaacggcatcaaccccgac
ggcgtggtccgaggctccggcatcttcgccggcggctggggcgccaagcgtgccgccgtg
tacggcgtggacgagcaggaactgggcaagtactacgcccagcgcacgctcctcaagcgc
gaagtcctcccggagcacgtggccaatgccgcgtccgtgctcaccagcaacgagctctcc
cacaccaccggcctccacatccctgtggacgcgggcgtggcagcagccttcctgcgctag

DBGET integrated database retrieval system