KEGG   Paenarthrobacter aurescens: AAur_4009Help
Entry
AAur_4009         CDS       T00447                                 

Definition
(GenBank) putative agmatinase (speB)
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
aau  Paenarthrobacter aurescens
Pathway
aau00330  Arginine and proline metabolism
aau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AAur_4009
Enzymes [BR:aau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AAur_4009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489 Cyt-b5
Motif
Other DBs
NCBI-ProteinID: ABM07738
UniProt: A1RBR9
Position
4382509..4383582
Genome map
AA seq 357 aa AA seqDB search
MELLTSRSTASTPHPKDSSMATHQPIGPVDATKVPRYAGLGTFARLPQIDRVPDYDIAIV
GVPFDGGTSFRPGARFGPAAVREASRLLRPGYHPELDVEPVYEAQVVDAGDIACTPYDIT
RAVREIEEQALPLISGGNGLSEDKRLISIGGDHTIALPMLRALNKVHGPVALLHFDAHLD
TWDTYFDQPITHGTIFRRAFEEGLLVEDKSMHVGIRGPVYDRNDFLRDHEFGFQIIRCSD
LDVIGVPAAIQRVKDRLGDTPVYVSIDIDVLDPAFAPGTGTPEMGGLHSRELLALLRGLN
GINIVGADVVEVAPAYDHADITTVAAATLVFDLLGLMVNRSKATAGRELASASRTAS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaattacttacttcccgctcaacggcgagcacccctcaccccaaggattcttcaatg
gcaacgcatcagcccatcggccctgtcgacgcaaccaaagttccccggtatgcaggactc
ggtaccttcgcccgtctcccccaaatcgaccgcgtcccggactacgacatcgcgatcgta
ggagtaccgttcgacggcggaacctccttccggccgggcgcccgtttcggccctgccgca
gtccgcgaggcctcccggctcctccgcccgggctatcacccggagctcgacgttgaaccg
gtatacgaagcccaagtggtggacgccggcgatattgcctgcaccccctacgacatcact
agggcagtccgcgagatcgaggagcaagcgttgcccctgatcagcggaggcaacgggctc
agcgaggacaagcgactcatctcgatcggcggcgaccacaccatcgccctgcccatgctg
cgagcgctgaacaaggttcatggtccggtggcactgctgcatttcgacgcccacctggac
acgtgggacacctacttcgaccagcccatcacgcacggaaccatcttccgtcgggcgttc
gaggaaggcctccttgtggaggacaagtccatgcacgtgggtatccgcggcccggtctat
gaccgcaacgacttcctccgcgaccacgaattcggcttccagatcatccgttgctcggac
ctggacgttattggggtcccggcggccattcagcgggtgaaggaccggctgggcgatacc
ccggtgtacgtttccatcgatatcgacgtcctggatccggcgttcgcacccggcaccggc
accccggagatgggcgggctccactcccgcgaactccttgccctgctccgcggactgaac
ggcatcaacatcgtaggtgccgacgtcgttgaggtcgccccggcgtatgaccacgctgat
atcaccacggtcgccgcggccaccctggtcttcgaccttctcggcctcatggtgaaccgc
agcaaggccaccgctggccgcgaactggcttcggcatcccggaccgcgtcatga

DBGET integrated database retrieval system