KEGG   Arthrobacter aurescens: AAur_4075Help
Entry
AAur_4075         CDS       T00447                                 

Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aau  Arthrobacter aurescens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AAur_4075
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AAur_4075
Enzymes [BR:aau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AAur_4075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4451850..4453895
Genome map
AA seq 681 aa AA seqDB search
MQRQRTSLMTAAATALLMTGAGVITAAGTAVAAPPTTAGTTTTVSASPDIEAMIAGMTLD
EKIGQMTWTHVYGSSADDASMAAKNQERYGVNTPAEVVEKYNLGGVLYFAWSGNTNNPQQ
VAGLSNGLQQTALREDGNGIPLAVTIDQEGGLVARIGPPATVLPGNMALGATADANLAKA
QGEILGSEMRAMGINVDFAPVLDLNSNPDNPVIGIRSMGEDPALVSALGVAQIEGIQAHN
VGAAAKHFPGHGDTSVDSHYGLPTVTYDRATLNEHLKPFKAAIDGGVDMVMTAHIIVEAI
DAEMPGTLSHKVLTGLLRDEMGFKGLVTTDALDMAAMAAEWPQEEIAVKAIQAGSDILLN
SPDVDASFAGVRAAVESGEITETRLDESVRRILEWKVKRGVFEQPMADPAAVDTLVGSAE
NLATAKLISDRAVTLVRNENGVLPLASGSSVLMVGAGSAWPELAGPMLKDQGFTVTEDYE
DGASPSAAYRARAVAAAGNVDAVVFASYNATSNAAQQQMVAELAATGTPVIVVATRNPYD
INVFPGADAVLNSYGVKEVNFHGAVRAISGAVNPSGKLPVNVPKADASGVLLPLGFGLSY
EITTPAPVTFTDRPGHGQDGYTIPSVPGVAYLIDGKEVAAGSYRKPSGTVTVTAERLPGY
VFTDGSVTEWTHTFTTGLPKS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagacaacgaacatcactcatgacggcggccgccacggcgctgctcatgacgggc
gcgggggtcatcaccgcggcgggcacggcagtcgcagccccacccaccaccgcgggaact
acgacgacggtctccgcctcgcctgacatcgaggcgatgattgccggcatgacgctggac
gaaaagatcggccagatgacgtggactcacgtttacggttcatcggcggacgacgcctcc
atggcagcaaagaatcaagaacggtacggcgtcaatacacccgccgaggtggtggaaaag
tacaaccttggcggcgttctctactttgcatggtccggcaacaccaacaacccgcagcag
gttgcgggcctttccaacggcttgcagcaaacggccttgcgagaggacgggaacggcatt
ccactggcagtcaccatcgaccaggaaggcggtttggttgcccgcattgggccgcccgcc
acagtcctcccgggcaacatggccctcggcgccaccgcggatgcgaatcttgccaaagca
caaggtgaaatccttggctccgaaatgcgcgccatgggtatcaacgttgatttcgcgccg
gtccttgacctgaactccaaccctgacaacccggtcatcggaatccgatccatgggcgag
gacccggccctggtcagtgccctcggtgttgcccagatcgaaggcattcaagcgcacaac
gtaggcgcggccgccaagcacttccccggccacggcgacacctcagtggattcccactac
ggactgcccaccgtcacctacgatcgcgcaacactcaatgagcacctgaaacccttcaaa
gctgccattgacggcggggtggacatggtcatgacggcccacatcattgttgaggccatc
gacgcggaaatgcccggcaccctgtcccacaaggtactcaccggtttgcttcgcgatgag
atgggcttcaaggggttggtgacaactgatgccttggatatggccgcaatggccgccgag
tggccccaggaagaaatcgcagtcaaggcgatccaggccggatctgacatcctcctcaac
tccccggacgtggacgcgtcgttcgccggggttcgcgccgccgtcgaatccggcgagatc
accgagacccgcctggatgagtccgtccgacggatccttgaatggaaggtcaagcgtggg
gtcttcgagcagcctatggcagaccccgccgcggtggacaccctggtgggaagcgcagag
aacctggccacggcaaagctgatctccgaccgcgccgtcaccttggtacgcaatgagaac
ggggtcttgccgctcgcttcgggcagctcggtgctcatggtgggtgccggttcagcgtgg
cccgagctcgcgggaccaatgctcaaggatcagggattcacagtcaccgaagactacgag
gatggggcctcgccctccgcggcctaccgcgcacgtgcggtggctgccgccggcaacgtc
gatgccgtggtcttcgcttcctacaacgcgaccagcaatgctgcgcagcaacagatggtc
gcggaactcgccgccaccggcacaccggtgatcgttgtggcaacccgcaatccctacgac
atcaacgtcttccccggcgccgacgccgtacttaacagttatggagtcaaagaggtcaat
ttccacggtgctgtccgtgccatctcaggtgcggtcaaccccagcggcaagctgccggtc
aacgtgccgaaggccgacgccagcggtgtcctcctgccgttgggcttcgggctgagctac
gaaattacgacgccggcccccgtcaccttcacggaccgcccgggtcatgggcaggacggt
tacaccatcccctccgtcccgggtgttgcgtacctgattgacggcaaggaagtcgccgcc
ggaagctataggaagccttcaggcactgtgaccgtcacagcggaacggctgcccgggtat
gtcttcaccgacggttccgtcaccgagtggacgcacaccttcaccacagggctccccaaa
tcctag

DBGET integrated database retrieval system