KEGG   Arthrobacter aurescens: AAur_4082Help
Entry
AAur_4082         CDS       T00447                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
aau  Arthrobacter aurescens
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aau00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4459997..4462039
Genome map
AA seq 680 aa AA seqDB search
MTDVLQAPATQRAPAPWVQRPAGLCYGGDYNPEQWPREVWVEDIALMKDAGINLVSIGIF
SWVLLEPREGEYHFEWLDDLMDLLADAGISVDLGTPTAAPPAWFWKKYPQSRPVTREGVT
LGNGSRGMASPSSPEYRRAATNITEQLARRYASHPALVLWHVHNEFGAPVSESYDAQSVL
AFRDWLRHRYGTLDALNQAWGTLFWGQKYGEWDEIDAPRLSASVSNQAQRLDFRRFTSDA
MLQCFIAERDVIKKYTPHLPVTTNFMATNCLSADYWAWAKEVDIVANDHYLVAQRTDNHV
LLSMDADLTRSLAGNRPWMLMEHSTGAVNWQGRNIAKRPGELARNSLSHLARGADAIMFF
QFRASRYGAEKFHSAMLPHAGTGTRIWREVMDLGEDLGKLSPVKGSVVKSRVAILWDVES
FWAQDLEWRPSSDLDHRERIESFYSVLWNRGISVDFAHPEADLSGYDLVLAPALYLVGDK
AAANISRYVHDGGHLMVSYFSGIVDANDTVPAGASPGGLRDVLGLEIHEFLPLRENETVT
MGNGATGTIWSEEIHPGTANVLSRYVDGPAAAGPAITRNEFGDGTAWYISTKLDGGHLAD
VVLDAVRAAGIEPGVQPPAGLEVASRDSEDGTFTFLINHTDADAEYPARGRNLISGEDVS
GTAHIPAGTICVVHTPAEQR
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtcctgcaggcccccgccacccaacgcgcacccgcgccttgggtacagcga
ccggccggcctttgctacggcggggattacaaccccgagcaatggccccgcgaggtctgg
gtggaagacatcgcgctgatgaaagacgccgggatcaacctggtcagtatcggcatcttc
tcctgggtgttgctcgaaccacgcgaaggtgaataccacttcgaatggcttgatgacttg
atggacctgctggccgatgccggcatcagcgtggacctcggaacacctacggcggcaccg
cccgcatggttctggaagaagtacccccagtcgcgtcccgtgacccgcgagggcgtcacc
ttgggcaacggatcgcgtggcatggccagccccagctcgccggaataccgccgggcggcc
accaacatcaccgaacagcttgcacgccgctacgcttcccaccccgcgctggttctttgg
cacgtccacaatgaattcggcgcaccggtcagtgagtcctacgacgcgcagtccgtgctg
gcgttccgcgattggctccgccaccgttatggcaccttggacgccctgaaccaggcctgg
ggcacccttttctgggggcagaagtacggcgagtgggatgagatcgacgcacccaggctt
tcagccagcgtcagcaaccaggcacagcggctcgacttccgccggttcacctcggacgcc
atgctgcagtgcttcattgccgagcgcgatgtcatcaaaaagtacacgccccaccttccg
gtgaccaccaacttcatggccaccaactgcctttcagctgactactgggcctgggccaag
gaagtggacatcgttgcgaacgaccactacctggttgcgcagcgcacggacaaccacgtt
cttctctccatggatgccgacctcacgcgatccctggcgggcaaccggccctggatgctg
atggaacactccaccggggccgtgaactggcagggacggaacatcgccaaacggccgggc
gaattagcccgcaacagcctgtcccacctggcccgcggggcggacgccatcatgttcttc
cagttccgcgcatctcgctatggcgcggaaaagtttcactccgccatgctcccgcacgcc
ggcaccggtacccggatctggcgcgaggtcatggacttgggcgaagacctcgggaaactc
tcccctgtgaagggctccgtcgtgaagtctcgcgtggccatcctctgggacgtggaatca
ttctgggcgcaagatcttgaatggcggcccagcagcgatcttgaccaccgcgaacggatc
gaatccttctactccgtcctgtggaaccgcgggatcagtgtggacttcgcccaccccgaa
gccgacctctccggttacgacctggtcctcgccccggccctctacctggtgggtgacaag
gcagccgcaaacatcagccgctacgtccacgacggcggacatctgatggtgtcctatttc
tccggcatcgtcgatgccaacgacaccgtcccagcaggcgcctcccccggtggcctccgc
gacgtcctcggtttggagatccacgaattcctgcccttgcgtgagaacgaaaccgtcacc
atgggcaacggcgccaccggaaccatttggtcggaggaaattcaccccggcaccgccaac
gtgctgagccgctatgttgacggccctgcggccgccggcccggccattacgcggaacgaa
ttcggcgacggcaccgcttggtacatttccacaaagctcgacggcggccacctcgccgac
gtcgtactggacgccgtgagggcggcaggaattgagcctggcgtccaaccgccggcgggg
ctggaggttgcttcacgcgattcagaggatggcactttcaccttcctgatcaaccacacg
gatgccgacgctgaatacccggcgaggggacgcaacctgatctccggcgaggacgtcagc
ggaacagcacacattcccgccggcaccatctgcgtggtccacaccccagcggaacagcgc
tga

DBGET integrated database retrieval system