KEGG   Arthrobacter aurescens: AAur_4082Help
Entry
AAur_4082         CDS       T00447                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
aau  Arthrobacter aurescens
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AAur_4082
Enzymes [BR:aau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AAur_4082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4459997..4462039
Genome map
AA seq 680 aa AA seqDB search
MTDVLQAPATQRAPAPWVQRPAGLCYGGDYNPEQWPREVWVEDIALMKDAGINLVSIGIF
SWVLLEPREGEYHFEWLDDLMDLLADAGISVDLGTPTAAPPAWFWKKYPQSRPVTREGVT
LGNGSRGMASPSSPEYRRAATNITEQLARRYASHPALVLWHVHNEFGAPVSESYDAQSVL
AFRDWLRHRYGTLDALNQAWGTLFWGQKYGEWDEIDAPRLSASVSNQAQRLDFRRFTSDA
MLQCFIAERDVIKKYTPHLPVTTNFMATNCLSADYWAWAKEVDIVANDHYLVAQRTDNHV
LLSMDADLTRSLAGNRPWMLMEHSTGAVNWQGRNIAKRPGELARNSLSHLARGADAIMFF
QFRASRYGAEKFHSAMLPHAGTGTRIWREVMDLGEDLGKLSPVKGSVVKSRVAILWDVES
FWAQDLEWRPSSDLDHRERIESFYSVLWNRGISVDFAHPEADLSGYDLVLAPALYLVGDK
AAANISRYVHDGGHLMVSYFSGIVDANDTVPAGASPGGLRDVLGLEIHEFLPLRENETVT
MGNGATGTIWSEEIHPGTANVLSRYVDGPAAAGPAITRNEFGDGTAWYISTKLDGGHLAD
VVLDAVRAAGIEPGVQPPAGLEVASRDSEDGTFTFLINHTDADAEYPARGRNLISGEDVS
GTAHIPAGTICVVHTPAEQR
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtcctgcaggcccccgccacccaacgcgcacccgcgccttgggtacagcga
ccggccggcctttgctacggcggggattacaaccccgagcaatggccccgcgaggtctgg
gtggaagacatcgcgctgatgaaagacgccgggatcaacctggtcagtatcggcatcttc
tcctgggtgttgctcgaaccacgcgaaggtgaataccacttcgaatggcttgatgacttg
atggacctgctggccgatgccggcatcagcgtggacctcggaacacctacggcggcaccg
cccgcatggttctggaagaagtacccccagtcgcgtcccgtgacccgcgagggcgtcacc
ttgggcaacggatcgcgtggcatggccagccccagctcgccggaataccgccgggcggcc
accaacatcaccgaacagcttgcacgccgctacgcttcccaccccgcgctggttctttgg
cacgtccacaatgaattcggcgcaccggtcagtgagtcctacgacgcgcagtccgtgctg
gcgttccgcgattggctccgccaccgttatggcaccttggacgccctgaaccaggcctgg
ggcacccttttctgggggcagaagtacggcgagtgggatgagatcgacgcacccaggctt
tcagccagcgtcagcaaccaggcacagcggctcgacttccgccggttcacctcggacgcc
atgctgcagtgcttcattgccgagcgcgatgtcatcaaaaagtacacgccccaccttccg
gtgaccaccaacttcatggccaccaactgcctttcagctgactactgggcctgggccaag
gaagtggacatcgttgcgaacgaccactacctggttgcgcagcgcacggacaaccacgtt
cttctctccatggatgccgacctcacgcgatccctggcgggcaaccggccctggatgctg
atggaacactccaccggggccgtgaactggcagggacggaacatcgccaaacggccgggc
gaattagcccgcaacagcctgtcccacctggcccgcggggcggacgccatcatgttcttc
cagttccgcgcatctcgctatggcgcggaaaagtttcactccgccatgctcccgcacgcc
ggcaccggtacccggatctggcgcgaggtcatggacttgggcgaagacctcgggaaactc
tcccctgtgaagggctccgtcgtgaagtctcgcgtggccatcctctgggacgtggaatca
ttctgggcgcaagatcttgaatggcggcccagcagcgatcttgaccaccgcgaacggatc
gaatccttctactccgtcctgtggaaccgcgggatcagtgtggacttcgcccaccccgaa
gccgacctctccggttacgacctggtcctcgccccggccctctacctggtgggtgacaag
gcagccgcaaacatcagccgctacgtccacgacggcggacatctgatggtgtcctatttc
tccggcatcgtcgatgccaacgacaccgtcccagcaggcgcctcccccggtggcctccgc
gacgtcctcggtttggagatccacgaattcctgcccttgcgtgagaacgaaaccgtcacc
atgggcaacggcgccaccggaaccatttggtcggaggaaattcaccccggcaccgccaac
gtgctgagccgctatgttgacggccctgcggccgccggcccggccattacgcggaacgaa
ttcggcgacggcaccgcttggtacatttccacaaagctcgacggcggccacctcgccgac
gtcgtactggacgccgtgagggcggcaggaattgagcctggcgtccaaccgccggcgggg
ctggaggttgcttcacgcgattcagaggatggcactttcaccttcctgatcaaccacacg
gatgccgacgctgaatacccggcgaggggacgcaacctgatctccggcgaggacgtcagc
ggaacagcacacattcccgccggcaccatctgcgtggtccacaccccagcggaacagcgc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system