KEGG   Arthrobacter aurescens: AAur_4089Help
Entry
AAur_4089         CDS       T00447                                 

Gene name
nahA
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aau  Arthrobacter aurescens
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AAur_4089 (nahA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AAur_4089 (nahA)
Enzymes [BR:aau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AAur_4089 (nahA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4467862..4469484)
Genome map
AA seq 540 aa AA seqDB search
MSAFHQLIPAPWSFSAGTGELELDAGTSVGADPELRGPRRWLTRALGGATGWDLAPAPAR
EAGIRLLLDPSLDAEAYRLEVSDAVVISAGGAAGAFYGAQTLLQLLGPAALRQAPVVAVE
GWSVPRVSVEDKPRFGYRGTMLDVARHFMPKDNVLRFIEVMAMHKLNVLHLHLTDDQGWR
MQINRYPKLTETGAWRRESSLGSWRAGVFDGRPHGGFYTQDDLREIVAFAADRHITVIPE
IDVPGHSQAAIAAYPELGAGPADGSSPVEVWTRWGINETVLEVSETSLEFYRNVLDEVVE
IFPSPWISLGGDEVPLTQWQASAQAQAKAAELGLDDVSGLHSWFVGQLALHLKHHGRATS
VWDEIGDGGLPDGALVASWRGYEGGIDALRKGYDVVMCPEHKLYLDHRQADGDDEPVPVG
FVTTLQAVYEFEPLPGVEGTDFPGRLLGAQANIWSEHLDSPRRVQFAAFPRLSAISEVFW
SNPAGRDYDEFLTRLTGAHLARLEAMGVEYRPLSGPAPWQQRPGVEGWKRDYDAEQLVRN
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtttcaccaattgatcccagccccgtggtccttctccgcaggcacgggcgag
ttggagctcgacgccggcacttccgtgggtgccgaccctgaactgcgcggtcctcgccgc
tggctcacccgggctttgggcggagctacgggttgggacctggctcccgcgcctgctcgt
gaggcgggcatccgcctcctgctggacccttcgctggacgccgaggcctaccgcttggag
gtgagtgacgccgtcgtgatttctgcgggtggcgccgctggcgctttctacggtgcgcag
acgctattgcagttgttgggaccagcggcgttgaggcaggctcctgttgttgctgttgag
ggatggtcggttccccgcgtgtctgtggaggacaagccgcgattcggctaccgcgggacc
atgctggatgtcgcgcggcacttcatgcccaaggacaacgtgctccggttcatcgaggtg
atggccatgcacaaactcaacgttcttcacctgcacctcacggacgatcagggctggcgt
atgcaaattaaccgctaccccaagctgaccgaaactggtgcgtggcgccgggagtcgtcg
cttggttcctggcgcgcaggagtattcgacggccgcccacacggtggtttctatacgcag
gacgatctccgggagatcgtggcgttcgccgcggaccggcatatcactgtcatcccggag
atcgatgttccgggccacagccaagctgccatcgcggcgtatccggagctcggtgcgggc
ccggctgacggttcatctcctgtggaggtatggacgcggtggggcatcaatgagaccgtc
ttggaagtctccgaaacctcgctggagttctaccggaatgtcctggacgaggtggtggag
atcttcccctccccgtggataagcctgggcggcgacgaagtgccactcacgcaatggcag
gcgagtgcccaagcacaggcaaaggctgcagagttgggcttggacgacgtttccggcttg
cacagttggttcgtcgggcagctggcgttgcatctgaagcaccacggccgcgccacgtcc
gtgtgggacgagatcggcgacggcggccttccggacggtgcgcttgtggcgtcctggcgc
gggtacgaaggcgggattgacgccctgcgcaagggctacgacgttgtgatgtgccctgag
cacaagctctacctggaccaccgccaggccgacggtgacgacgaacccgtccccgttggt
ttcgtgaccaccttgcaggctgtctacgagtttgagccgttgccaggagttgaaggcacg
gacttcccgggcaggctcctaggagcccaagccaacatctggagcgagcacttggattca
ccgcgccgcgtgcagttcgcagcgttcccgcgcctcagcgccatctccgaagtgttctgg
tccaaccccgcgggccgggactacgatgagttcctgacccgactcacaggtgcacacttg
gcgcggctcgaggccatgggcgtggagtatcggcctttgtccggtcccgcgccatggcag
cagcggccgggtgtggagggttggaaacgcgattacgacgccgagcagctcgtgaggaac
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system