KEGG   Arthrobacter aurescens: AAur_pTC20218Help
Entry
AAur_pTC20218     CDS       T00447                                 

Definition
putative alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
aau  Arthrobacter aurescens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:aau01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aau00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:aau00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:aau00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:aau00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:aau00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
TC2:235856..236857
Genome map
AA seq 333 aa AA seqDB search
MGLCHSDLHYLKGSLDISLPVVLGHEVAGIVERVGSAVTRIKTGERVVATVTPSCGACRN
CISGRPTQCERVDSMRERQRPRLLSPDGSSVESLGGIGAFAEAFLVKEASVAVVGSDLPP
QVACLLGCCISTGVGAVIHGAKVGPEDTVAVIGCGGVGIAAIQGARLAGARRIIAIDAVP
AKLELARNFGATDTVVSSSDPTETLIQVRSLLPQGVSHAIEAVGRSQTAELAFSLLRPNG
TATILGLMPTGSELRIPADALVYGDRHLQGAYMGANRFLSDVDMFTDHYLNNRLDLDAMV
TKELPFERINEGFEAMAEASTIRVVLNMTDRQL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgggcctttgccatagcgatctgcactatctgaaggggtcgctggatatctccctgccg
gtggtccttgggcatgaagtcgcaggcattgtcgagcgcgtcggttctgcagtcacaaga
attaagactggtgaaagggtcgtggcaacggtcaccccctcctgcggggcatgccgcaac
tgcataagcgggcgcccgacccagtgcgaacgagtcgactcgatgcgtgagcggcagcga
cccaggctgctctcacctgatggatcaagcgttgagtcgctcggcggtatcggcgcattt
gcagaggccttcctcgtgaaggaggcatccgttgcagtggtcggctcggatctgcctccc
caggtggcgtgtcttctcggttgctgcattagtacaggagtcggcgcggttattcacggc
gcaaaggtaggaccagaggatactgttgccgtgatcggttgcggcggtgtcggaatagcg
gccattcaaggtgccaggttggctggggcacgacgaataattgccattgacgctgtgccg
gcgaagctggagctcgcccgtaacttcggtgccacggacactgttgtctcatcatccgac
ccgacagaaacactcatccaggtccgatcacttcttccccaaggtgtcagccatgcaatc
gaggcggtgggccgcagccagacagcagaactcgccttttcgctcctgcgcccgaacgga
accgccaccatcctcggtctcatgcccacagggtccgaactgcgtatcccagcagatgca
ctcgtatacggcgaccgacacctgcaaggcgcctacatgggcgcgaacaggttcctcagc
gacgtcgacatgttcacggaccactacctgaacaaccgactggatctcgatgcaatggtc
accaaggaactgcccttcgaacgtatcaacgagggattcgaagcgatggcggaagcctcg
acgatccgagttgtgctgaacatgaccgacaggcaactgtga

DBGET integrated database retrieval system