KEGG   Arthrobacter aurescens: AAur_pTC20218Help
Entry
AAur_pTC20218     CDS       T00447                                 

Definition
putative alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
aau  Arthrobacter aurescens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aau00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AAur_pTC20218
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAur_pTC20218
  Lipid metabolism
   00071 Fatty acid degradation
    AAur_pTC20218
  Amino acid metabolism
   00350 Tyrosine metabolism
    AAur_pTC20218
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AAur_pTC20218
   00626 Naphthalene degradation
    AAur_pTC20218
Enzymes [BR:aau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AAur_pTC20218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
TC2:235856..236857
Genome map
AA seq 333 aa AA seqDB search
MGLCHSDLHYLKGSLDISLPVVLGHEVAGIVERVGSAVTRIKTGERVVATVTPSCGACRN
CISGRPTQCERVDSMRERQRPRLLSPDGSSVESLGGIGAFAEAFLVKEASVAVVGSDLPP
QVACLLGCCISTGVGAVIHGAKVGPEDTVAVIGCGGVGIAAIQGARLAGARRIIAIDAVP
AKLELARNFGATDTVVSSSDPTETLIQVRSLLPQGVSHAIEAVGRSQTAELAFSLLRPNG
TATILGLMPTGSELRIPADALVYGDRHLQGAYMGANRFLSDVDMFTDHYLNNRLDLDAMV
TKELPFERINEGFEAMAEASTIRVVLNMTDRQL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgggcctttgccatagcgatctgcactatctgaaggggtcgctggatatctccctgccg
gtggtccttgggcatgaagtcgcaggcattgtcgagcgcgtcggttctgcagtcacaaga
attaagactggtgaaagggtcgtggcaacggtcaccccctcctgcggggcatgccgcaac
tgcataagcgggcgcccgacccagtgcgaacgagtcgactcgatgcgtgagcggcagcga
cccaggctgctctcacctgatggatcaagcgttgagtcgctcggcggtatcggcgcattt
gcagaggccttcctcgtgaaggaggcatccgttgcagtggtcggctcggatctgcctccc
caggtggcgtgtcttctcggttgctgcattagtacaggagtcggcgcggttattcacggc
gcaaaggtaggaccagaggatactgttgccgtgatcggttgcggcggtgtcggaatagcg
gccattcaaggtgccaggttggctggggcacgacgaataattgccattgacgctgtgccg
gcgaagctggagctcgcccgtaacttcggtgccacggacactgttgtctcatcatccgac
ccgacagaaacactcatccaggtccgatcacttcttccccaaggtgtcagccatgcaatc
gaggcggtgggccgcagccagacagcagaactcgccttttcgctcctgcgcccgaacgga
accgccaccatcctcggtctcatgcccacagggtccgaactgcgtatcccagcagatgca
ctcgtatacggcgaccgacacctgcaaggcgcctacatgggcgcgaacaggttcctcagc
gacgtcgacatgttcacggaccactacctgaacaaccgactggatctcgatgcaatggtc
accaaggaactgcccttcgaacgtatcaacgagggattcgaagcgatggcggaagcctcg
acgatccgagttgtgctgaacatgaccgacaggcaactgtga

DBGET integrated database retrieval system