KEGG   Acidovorax citrulli: Aave_0142Help
Entry
Aave_0142         CDS       T00451                                 

Definition
threonine dehydratase (EC:4.3.1.19)
Orthology
K01754  
threonine dehydratase [EC:4.3.1.19]
Organism
aav  Acidovorax citrulli
Pathway
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Class
Metabolism; Overview; Carbon metabolism [PATH:aav01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aav01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aav00260]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:aav00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(152775..153983)
Genome map
AA seq 402 aa AA seqDB search
MAHMLTLPDIQAAAARLQGQVLDTPCVESRTLSQIVGAQVFLKFENLQFTASFKERGACN
KLSQLSPEEQRRGVIAMSAGNHAQGVAYHAQRLGLAAVIVMPRFTPGVKVERTRGFGAEV
VLHGDTLEEARAHAYALAEERGLTFVHPYDDEAVAAGQGTVGLEMLQAVPDLDCLAIAVG
GGGLIAGIATAAKALKPGIEIIGVQTSRFPAMVNAVKGTQHPQGTSTIAEGIAVGTPGQV
TREVIARLVDDLLLVDEGDIEQAVLMLLEIEKTLVEGAGAAGLAALLRHPERFRGKRVGL
VLCGGNIDPLLLAAIIERGMVRSGRLARVKVSARDIPGVLARITATVAEAGANIEEVHHQ
RAFTMLAAQNVEIELVLQTRGREHVQQVLACLRQASMEAELL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacatgctgaccctccccgacatccaggccgccgccgcccgcctccagggccag
gtgctcgacaccccctgcgtcgaatcgcgcacgctctcgcagatcgtgggcgcgcaggtg
ttcctcaagttcgagaacctgcagttcaccgcctccttcaaggagcgtggtgcctgcaac
aagctgagccagctttcgcccgaggagcagcggcgcggcgtgatcgccatgagcgccggc
aaccatgcccagggcgtggcctaccacgcgcagcgcctgggcctggccgccgtgatcgtg
atgccgcgcttcacgcccggcgtgaaggtggagcgcacgcgcggcttcggcgccgaggtc
gtgctgcacggcgacacgctggaggaggctcgcgcgcatgcctatgccctggccgaggag
cgggggctcactttcgtgcatccctacgacgacgaggccgtcgccgcaggccagggcacc
gtcggcctggagatgctgcaggcggtgccggacctggactgcctggccatcgccgtgggc
ggaggcggcctgatcgcgggcatcgccaccgcggccaaggccctgaaaccgggcatcgag
atcatcggcgtgcagacctcgcgcttcccggccatggtcaacgcggtcaagggcacgcag
cacccgcagggcacctccaccatcgccgagggcatcgccgtgggcacgcccggccaggtg
acccgcgaggtgatcgcgcggctcgtggacgacctgctgctcgtggacgagggcgacatc
gagcaggccgtgctcatgctgctggaaatcgagaagaccctcgtcgagggcgccggcgcc
gccggcctggcagcgctgcttcggcacccggagcgcttccgcggcaagcgggtgggcctg
gtgctgtgcggcggcaacatcgaccccttgctgctggcggccatcatcgagcgcggcatg
gtgcgctccgggcgcctggcgcgcgtcaaggtgagtgcgcgcgacatcccgggcgtgctc
gcgcgcatcacggccacggtggccgaagcgggcgccaacatcgaggaagtccaccaccag
cgcgccttcaccatgctggccgcccagaacgtggagatcgaactcgtgctgcagacgcgg
ggccgcgagcatgtgcagcaggtactggcctgcctccgccaagcgtccatggaagccgaa
ctcctgtga

DBGET integrated database retrieval system