KEGG   Acidovorax citrulli: Aave_0162Help
Entry
Aave_0162         CDS       T00451                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
aav  Acidovorax citrulli
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
179081..182077
Genome map
AA seq 998 aa AA seqDB search
MKLHFEPDLDYQKQAIESVCDLFRGQEVCRTEFTVTMRLPEQQLTLGVAETDLGVGNRLT
LLDDQLLKNLQDVQMRNGLAPAGTLASGDFTVEMETGTGKTYVYLRTIFELNKRYGFTKF
VIVVPSVAIKEGVYKSLQITEEHFKALYAGVPVDFFLYDSAKLGQVRNFATSSAIQVMVV
TVGAINKKDVNNLYKDSEKTGGEKPIDLIRATHPIVIVDEPQSVDGGLSGAGKTALDAMN
PLCTLRYSATHADKHHMVFRLDAVDAYERKLVKQIEVAAATVEDAFNKPYVRLVAVTNKR
GRISAQLELYVQEAAGPKLREESVSDGDDLQQVTKRAIYADFRVGEINTAKGSEFVELRY
PGGEVALAIGQAHGGVDELAVQREMIRRTIREHLEKEKLLRPKGIKVLSLFFIESVDRYR
KLDAQGQAVKGDYARIFEEEYRRAAKLPSYQSLFAEVDLTTAAEEVHNGYFSIDKKGGWT
DTADNNAAGRENAERAYNLIMKEKERLLDFATPLKFIFSHSALKEGWDNPNVFQICALRE
MGSERERRQTIGRGLRLCVNQAGERVRGFDVNRLTVIATESYEDFAENLQKEIEADTGIR
FGIVEPHQFAGIPVAGADGQVTAFGVEQSRLLWEHLKAAGQIDAKGKVQDSLKQALKDGT
LALPDAFAAQRTQVLELLRKVSGRLEVKNADERKTVALRKDADGKAITLGEEFKALWDRI
KHKTTYRVQFDNAKLLQDCTKALRDAPPIPKARLQWRKADIAIGKAGVETKEQKDGAYTV
GLDESGIELPDLLTDLQDRTQLTRRSLVSILTESGRLDDFRRNPQQFIEQTAEQINRCKR
LALVDGIKYQKLGDQQVYAQELFEQQELTGYLKSMLLDTAKSIHEHVVYDSATERDFAQA
LEFNQDVLLYAKLPNWFKVPTPLGNYNPDWAVLLQKDGVQRLYFVVETKSSLFADDLRDK
EWAKIECGRAHFAALATGENPARYLVARSLDDVLQTVN
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcatttcgagcccgatctggattaccagaagcaggccatcgagtcggtctgc
gacttgttccgaggtcaggaggtctgccggacggagttcaccgtcacgatgcgcctgcct
gagcaacagctcaccttgggtgtagccgaaaccgacctgggcgtgggcaaccgcctgacc
ctgctcgatgaccagttgctgaagaatctgcaggacgtccagatgcgcaacggcctggcg
ccagccggcacgctggcgtcaggcgacttcactgtcgagatggagactggtaccggtaag
acctacgtctacctgcgcacgatcttcgagttgaacaagcgctacggcttcaccaagttc
gtcatcgtcgtgccctcggtggccatcaaggaaggggtctacaagtcgctgcagatcacc
gaggaacacttcaaggccctgtacgccggcgtgccggtggacttcttcctgtacgactcg
gccaagctggggcaggtgcgcaacttcgccaccagctcggccatccaggtgatggtcgtg
acggtcggcgccatcaacaagaaggacgtcaacaacctctacaaggacagtgagaagacc
ggcggcgagaagcccatcgacctgatccgggccacgcaccccatcgtcatcgtcgacgag
ccgcagagcgtggacggcggcctgagcggcgcgggcaagaccgcgctggatgcgatgaac
ccgctgtgcaccttgcgctactcggccactcatgccgacaagcaccacatggtattccgg
ctggacgcagtggatgcctacgagcgcaagctggtcaagcagatcgaggtggcggcggct
accgtggaggacgccttcaacaagccctacgtgcggctggtagccgtcaccaacaagcgc
ggccgcatcagcgcgcagctggaactttatgtgcaagaggctgcggggcccaagctgagg
gaggagtccgtcagcgacggggatgacctgcagcaggtcaccaagcgcgcgatctatgcc
gacttccgcgtcggcgaaatcaacaccgccaagggctccgagttcgtcgagctgcgatac
cccggcggtgaggtggccctggccatcggccaggcgcacggcggcgtggacgagttggcc
gtgcagcgggagatgatccgccgcacgatccgcgagcatctggagaaagagaagctgttg
cggcccaagggcatcaaggtgctgtcgctgttcttcatcgagtcagtggatcgctaccgc
aagctcgatgcacaaggccaggcggtgaagggcgactacgcgcgcatcttcgaggaggag
tatcgccgcgcggccaagctgcccagctaccagagcctgttcgcggaggtggacctgacg
accgcagccgaggaggtgcacaacggctatttctccatcgacaagaagggcggctggaca
gatacggccgacaacaacgcggccggccgcgagaacgccgagcgggcctacaacctcatc
atgaaggagaaggagcggctgctggattttgccacgccgctgaagttcatcttcagccac
tccgccctcaaggaaggctgggacaaccccaacgtcttccagatttgcgcgctccgcgag
atgggctccgagcgtgaacggcgccagaccatcggccgcggcttgcgcctgtgtgtgaac
caggccggggagcgggtgcgcggcttcgacgtcaaccgcctgaccgtcatagcgaccgag
tcgtacgaggacttcgcggagaacctgcagaaggaaatcgaggccgacacgggcatccgc
ttcggcatcgtcgagccacaccagttcgccggcattccggtggccggcgctgacgggcag
gtgacggccttcggggtagagcagtccaggctgttgtgggaacacttgaaggctgccggc
cagatcgacgccaagggcaaggtgcaggactcgctcaagcaagccctgaaggacggcacg
cttgcattgcccgatgcgttcgccgcacagcgaacgcaggtgctggagctgctgcgcaag
gtgagcggtcgcctggaggtgaagaacgcggacgagcgcaagacggtggcgctgcgcaag
gacgcagatggcaaggcgatcacgctgggtgaggagttcaaggccctgtgggaccgcatc
aagcacaagactacctaccgggttcagttcgacaacgcgaagctgcttcaagactgcacg
aaggcgttgcgcgatgcgccgccaatccccaaggcgcgcctgcaatggcgcaaggccgac
atagccatcggcaaggcaggcgtcgagaccaaggagcaaaaggacggtgcctataccgtg
gggctggacgagtcgggcatcgagctgccagacctgttgacggacctgcaggaccgtacc
caattaacgcgccgcagcctggtctccatcttgaccgagtcggggcgcttggatgacttc
cgccgcaatccgcagcagttcatcgagcagacggccgagcagatcaaccgctgcaagcgc
ctagcgctggtcgatggcatcaagtatcagaagctgggtgaccagcaggtctacgcgcag
gagctgttcgagcagcaggagctgaccggctacctgaagagcatgcttctggacacggcc
aagtccatccacgagcatgtggtttacgactctgccaccgagcgcgactttgctcaggcg
ctggagttcaaccaggacgtgttgctgtatgccaagctgccgaactggttcaaggtgccc
acgccgctgggcaactacaatccggactgggctgtgctgctgcagaaggatggcgtgcag
cgcctgtacttcgtcgtggaaaccaagagcagcctctttgctgacgatctacgtgacaag
gagtgggccaagatcgagtgcggccgagcgcacttcgcagcactggcgaccggcgagaac
ccggcgcgctacttagtcgcgaggtccttggatgatgtgctgcagacggtcaactga

DBGET integrated database retrieval system