KEGG   Acidovorax citrulli: Aave_0408Help
Entry
Aave_0408         CDS       T00451                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
aav  Acidovorax citrulli
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aave_0408
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aave_0408
   00630 Glyoxylate and dicarboxylate metabolism
    Aave_0408
Enzymes [BR:aav01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Aave_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(438082..440382)
Genome map
AA seq 766 aa AA seqDB search
MRIKNSNTVAPAGDFPPRTSLFHPPNPPTMTDRTSVHGLQVATLLHRFIEERVLPGTGVD
AAAFWSGFDAIVRDLAPRNIALLAERDRLQSELDTWHKAHPGPVTDMAGYRAFLEKIGYL
VPQPAGVQATTANVDDELAIQAGPQLVVPILNARYALNAANARWGSLYDALYGTDVISEE
GGAEKGKGYNPVRGARVIAFARNVLDTSAPLAAGSHKDAKAYRVEGGRLAVELQDGSATG
LKDAAQFVGYQGDAAAPSSVLLRHNGLHLDIRIDRSTPIGKTDPAGVSDLVLEAALSTIL
DLEDSVAAVDAEDKVAGYANWLGILQGTLTESFAKGGQTVTRGLNADRIYTAPGGSGEVR
LHGRSLMFLRNVGHLMTNPAVLWTDAQGAQREIPEGILDAVVTTAIALHDLQGKGQGGIR
NSRKGSVYIVKPKMHGPAEVAFASELFARVERLLGLPENTVKLGIMDEERRTSVNLKACI
AAASARVAFINTGFLDRTGDEMHTAMQAGPMVRKGDMKASAWIQAYEKNNVLVGLSCGLR
GKAQIGKGMWAMPDMMKAMLEQKIAHPRAGANTAWVPSPTGATLHALHYHQVNVAEVQKE
LEKTSADAERDNLLTGLLTIPVAANPQWTDAEKQQELDNNAQGILGYVVRWIDQGVGCSK
VPDIHDVGLMEDRATLRISSQHIANWLLHGVVTEDQVRKTFERMAAVVDQQNAGDPAYRK
MAGRFAESAAYQAACDLVFKGVEQPSGYTEPLLHAWRLKVKAGAAR
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgcggataaaaaattcaaatacagtggctccagcgggggatttccccccgcgtacctcc
ttgttccacccgcccaatccacccaccatgaccgatcgcacctccgtccacggcctgcaa
gtggccacgcttctgcaccgattcatcgaagagcgcgtgctgcccggcacgggcgtcgat
gccgccgcgttctggtccggcttcgatgccatcgtgcgggacctggctccgcgcaatatc
gccctgctggccgagcgcgaccgcctgcaatccgaactggacacctggcacaaggcccac
cccggcccggtcaccgacatggcgggctaccgcgccttcctggagaagatcggctacctc
gtgccgcaacccgcaggcgtgcaggccaccaccgccaacgtggacgacgaactcgccatc
caggccggcccgcagctcgtggtgccgatcctgaacgcacgctacgcgctcaacgccgcc
aacgcgcgctggggcagcctgtacgacgcgctctatggcaccgacgtcatttccgaagag
ggcggcgccgaaaagggcaagggctacaacccggtgcgcggcgccagggtgatcgccttc
gcgcgcaacgtgctggacaccagcgccccgctcgccgccggctcgcacaaggatgcgaag
gcctaccgcgtcgaaggcggccgcctggccgtggagctgcaggacggctcggccacgggc
ctgaaggacgcggcccagttcgtgggctaccagggcgatgccgccgcaccgtcgtccgtg
ctgctgcgccacaacgggctgcacctggacatccggatcgaccgctccacgcccatcggc
aagaccgatcccgccggcgtgagcgacctggtgctggaagcggccctctccaccatcctc
gacctcgaagactccgtcgccgccgtcgatgccgaggacaaggtggccggctatgccaac
tggctgggcatcctgcagggcacgctgaccgaatccttcgccaagggcggccagaccgtc
acgcggggcctgaacgccgaccgcatctacaccgcgcccgggggcagcggcgaagtgcgc
ctgcacggccgctcgctcatgttcctgcgcaacgtgggccacctgatgaccaacccggcc
gtgctgtggaccgacgcgcagggcgcgcagcgcgagatcccggaaggcatcctggacgcg
gtggtcaccaccgccatcgcgctgcacgacctgcagggcaagggccagggcggcatccgc
aactcgcgcaagggcagcgtctatatcgtcaagcccaagatgcacggcccggccgaagtg
gccttcgccagcgaactcttcgcccgcgtggaacgcctgctgggcctgccggagaacacc
gtcaagctgggcatcatggacgaagagcgccgcaccagcgtgaacctgaaggcctgcatc
gccgccgcgtcggcccgggtggccttcatcaacaccggcttcctggaccgcaccggcgac
gagatgcacaccgccatgcaggccgggcccatggtgcgcaagggcgacatgaaggccagc
gcctggatccaggcctacgagaagaacaacgtgctggtgggcctgtcgtgcggcctgcgc
ggcaaggcgcagatcggcaagggcatgtgggccatgcccgacatgatgaaggccatgctg
gagcagaagatcgcccaccccagggccggcgccaacaccgcctgggtgcccagccccacg
ggcgccacgctgcacgccctgcattaccaccaggtcaacgtggccgaggtgcagaaggag
ctggaaaagaccagcgccgatgccgaacgcgacaacctgctcaccggcctgctgaccatt
cccgtcgccgccaacccgcaatggaccgacgccgagaagcagcaggagctggacaacaac
gcccagggcatcctcggctacgtggtgcgctggatcgaccagggcgtgggctgctccaag
gtacccgacatccacgacgtgggcctgatggaagaccgcgccacgctgcgcatcagcagc
cagcacatcgccaactggctgctgcatggcgtggtgaccgaggaccaggtgcggaaaacc
ttcgagcgcatggccgccgtggtggaccagcagaacgcgggtgatccggcctaccggaag
atggccggccgctttgccgagtctgccgcttaccaggccgcctgcgacctggtgttcaag
ggcgtggagcagcccagcggctataccgagccgctgctgcacgcctggcggctgaaggtg
aaggccggcgcggcacgctga

DBGET integrated database retrieval system