KEGG   Acidovorax citrulli: Aave_0602Help
Entry
Aave_0602         CDS       T00451                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aav  Acidovorax citrulli
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Aave_0602
Enzymes [BR:aav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Aave_0602
Exosome [BR:aav04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aave_0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(658866..660386)
Genome map
AA seq 506 aa AA seqDB search
MTYLLALDQGTSSSRSIVFDERGHIVAQAQQELPQIYPQPGWVEHDPVDIWRTQIATARQ
ALAQANIGPGDVRALGITNQRETTVLWNRRTGQPVHHAIVWQDRRAEPLCAELREQGHEP
MIQERTGLRIDAYFSATKLRWLLDQVPGARAAAEAGELAFGTVDSWLIWQLTGGKVHVTD
VSNASRTMLFNVHSNDWDDDLLALLRIPRKLLPRVQPSASDFGATDAALLGGAIPIGGVA
GDQQSALFGQACFTAGMAKNTYGTGCFMLMHTGSSFQTSRNGLLTTSAAQIAPRTGAGHG
APEPAFAMEGSVFVGGAVVQWLRDGLRAISSSSEVQSLAESVPDSGGVMMVPAFTGLGAP
YWKPDARGTITGLTRGTTIAHIARAALESIAYQSAALLQAMSRDAVAAGGAPVSELRVDG
GACVNDLLMQFQADLLGIPVVRPAVIETTALGAAYLAGLSSGVYAGTEALSALWRAERRF
LPTLSAARAQECMARWEHAVRQAALD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacctatctgctcgccctcgaccaaggcacctccagctcgcgcagcatcgtgttcgac
gagcgcgggcacatcgtcgcgcaggcgcagcaggagctgccgcagatctacccgcagccc
ggctgggtggagcacgacccggtggacatctggcgcacgcagatcgccacggcgcggcag
gcgctcgcgcaggcgaacataggccccggcgacgtgcgggcgctgggcatcaccaaccag
cgcgagacgacggtgctgtggaaccgccgcaccgggcagcccgtgcaccacgccatcgtc
tggcaggaccggcgggccgagccgctgtgcgccgagctgcgagaacagggccacgagccg
atgatccaggagcgcaccgggctgcgcatcgacgcgtatttctcggcgaccaagctgcgc
tggctgctggaccaggtgcctggtgcgcgcgccgccgccgaggccggcgagctggctttc
ggcacggtggacagctggctgatctggcagctgacgggcggcaaggtgcacgtgaccgac
gtgagcaatgcctcgcgcaccatgctgttcaatgtccattccaacgactgggatgacgat
ctcctggcgctgctgcgcatcccccggaagctgctgccgcgcgtgcagccttcggcgagc
gacttcggcgccacggacgcagcgctgctgggcggcgccatcccgatcggcggggtggcg
ggcgaccagcagagcgcgctgttcggccaggcgtgtttcaccgccggcatggccaagaac
acctacggcacgggctgcttcatgctgatgcacaccggcagcagtttccagacctcgcgc
aacggcctgctgacgaccagcgcggcgcagatcgctccccgaaccggcgcgggccacggg
gcgccggagccggccttcgccatggaaggcagcgtgttcgtgggtggcgcggtggtgcaa
tggctgcgcgacgggctgcgcgccatatcgagcagcagcgaggtgcagtcgctggccgag
agcgtgccggactccggcggcgtgatgatggtgccggccttcaccgggctgggcgcgccg
tattggaagcctgacgcccggggcaccatcaccggccttacccgcggcacgaccatcgcc
cacatcgcgcgcgcggcgctggagagcatcgcctaccagagcgcggcgctgctgcaggcg
atgagccgcgacgcggtggccgccggcggcgcgcccgtgagcgagctgcgggtggacggc
ggcgcctgcgtgaacgacctgctgatgcagttccaggccgacctgctgggcattcccgtg
gtgcggccggcggtgatcgagaccactgcgctgggagccgcctacctggcgggtctctcc
agcggggtctatgcgggcacggaagccctgtccgcgctgtggcgcgccgagcgtcggttc
ctgcccacgctgagcgccgcgcgcgcccaggaatgcatggcgcgctgggagcatgcggtg
cgccaggccgcgctggactga

DBGET integrated database retrieval system