KEGG   Acidovorax citrulli: Aave_0816Help
Entry
Aave_0816         CDS       T00451                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
aav  Acidovorax citrulli
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:aav00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:aav00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
881785..883344
Genome map
AA seq 519 aa AA seqDB search
MTEPQSPSGHPTPPLLGSVPEALEWLRAHAPQGALRTDSRQVEPGDIFIAWPGAATDGRM
HVGEALARGAAACLVEREGVEAFRFGAEGVAALRDLKAATGLLAADWFGMPTQRLDVVAV
TGTNGKTSTTWWIADALNLLAGSGLATHGGCGLIGTLGVGVPPSLQGTGLTTPDPVRLQQ
AFAGFVANGLGACAIEASSIGLAEHRLAGMRLRVAVFTNFTQDHLDYHAGMAAYWQAKSA
LFDWPGLQAAVVNIDDPRGGELSDTLAQRPIDLWTTSITGPARLQARDVTWGEGGLRFTV
AEGVQAHVLQTRVIGHYNIHNLLAVVASLRALGIPLEHALWACAQLAPVPGRMELIHEPG
QPLVAVDYAHTPDALEQALQALRPVAEQRGGRLWCVFGCGGNRDRAKRPLMGRIAQQRAD
AVIVTSDNPRNEAPGAILHEILLGTVAGTTVQAEPERDAAIARAIADADGRDVVLIAGKG
HEDYQETAGVRRPFSDAAHARAALARRESAAGGDAGGTA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagccccaatccccatcagggcatcccacgcccccgctgctcggctccgtgccg
gaggcgctggagtggctgcgcgcccatgccccgcagggtgcgctgcgcacggacagccgc
caggtcgagcctggcgacatcttcatcgcctggcccggcgctgccaccgatggccgcatg
cacgtgggcgaggccctcgcgcgcggcgcggcggcctgcctggtggagcgcgaaggcgtg
gaggccttccgcttcggcgccgaaggcgtggcggcgctgcgcgacctcaaggcggccacc
ggcctgctggccgccgactggttcggcatgcccacgcagcgcctggacgtggtggcggtg
accggcaccaacggcaagaccagcaccacctggtggatcgccgatgcgctcaacctgctc
gcaggcagcgggctggccacccatggcggctgcggcctgatcggcaccctgggcgtgggc
gtgccgccctcgctgcagggcacgggcctgaccacgcccgatcccgtgcggctgcagcag
gccttcgccggtttcgtggccaacgggctgggcgcctgcgccatcgaggcgtcctccatc
gggctcgcggagcaccgcctcgcgggcatgcgcctgcgcgtggccgtattcaccaacttc
acgcaggaccacctggactaccacgcgggcatggcggcctactggcaggccaagagcgcg
ctcttcgactggccagggctgcaggcggcggtcgtgaacatcgacgatccgcgcggcggt
gaactgtcggacacgctcgcgcagcgcccgatcgacctctggaccacctcgatcaccggc
ccggcccggctgcaggcccgcgacgtcacgtggggcgagggcggcctgcgcttcacggtg
gccgaaggcgtgcaggcccacgtgctgcagacgcgcgtgatcggccactacaacatccac
aacctgctcgccgtggtcgccagcctgcgcgcgctgggcattccgctggagcacgcgctc
tgggcctgcgcgcagctcgcgcccgtgcccggccgcatggagctcatccacgagccgggc
cagccgctggtggccgtggactacgcccacacgcccgatgcgctcgagcaggccctgcag
gcgctgcgccccgtggcggagcagcgcggcgggcggctgtggtgcgttttcggctgcggc
ggcaaccgcgaccgggccaagcggccgctcatgggccgcatcgcgcagcagcgcgccgac
gcggtgatcgtgaccagcgacaacccacgcaacgaggcgcccggcgccatcctgcacgag
atcctgctgggcacggtggccggcaccacggtgcaggccgagcccgagcgcgatgccgcc
atcgcgcgcgccatcgccgacgcggacgggcgcgacgtggtgctcatcgcgggcaagggg
cacgaggactaccaggagaccgcgggcgtgcgccggcctttctcggacgccgcccatgcg
cgcgccgcgctggcgcggcgcgagtccgcggccggcggggatgcggggggcacggcatga

DBGET integrated database retrieval system