KEGG   Acidovorax citrulli: Aave_0882Help
Entry
Aave_0882         CDS       T00451                                 

Definition
(GenBank) short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
aav  Acidovorax citrulli
Pathway
aav00071  Fatty acid degradation
aav00280  Valine, leucine and isoleucine degradation
aav00281  Geraniol degradation
aav00310  Lysine degradation
aav00360  Phenylalanine metabolism
aav00362  Benzoate degradation
aav00380  Tryptophan metabolism
aav00410  beta-Alanine metabolism
aav00627  Aminobenzoate degradation
aav00640  Propanoate metabolism
aav00650  Butanoate metabolism
aav00903  Limonene and pinene degradation
aav00930  Caprolactam degradation
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
aav01212  Fatty acid metabolism
Module
aav_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Aave_0882
   00650 Butanoate metabolism
    Aave_0882
  Lipid metabolism
   00071 Fatty acid degradation
    Aave_0882
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aave_0882
   00310 Lysine degradation
    Aave_0882
   00360 Phenylalanine metabolism
    Aave_0882
   00380 Tryptophan metabolism
    Aave_0882
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Aave_0882
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Aave_0882
   00281 Geraniol degradation
    Aave_0882
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Aave_0882
   00627 Aminobenzoate degradation
    Aave_0882
   00930 Caprolactam degradation
    Aave_0882
Enzymes [BR:aav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Aave_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABM31480
JGI: Aave0882
UniProt: A1TKJ2
Position
complement(958241..959020)
Genome map
AA seq 259 aa AA seqDB search
MAYEVIEVRTEADKVGVITLNRPKQLNALNDQLMDELGDALAAFDADERIGCIILTGSEK
AFAAGADIGAMAKYGFADAYKGDYITRNWERIRSIRKPVIAAVSGFALGGGCELAMMCDF
IIAADNAKFGQPEIKLGVIPGAGGTQRLPRAVGKSKAMDMALTARMMDAQEAERAGLVSR
VVPYDKLMDEALGAALVIAGFSQVAVMAAKETVNRAFEGALSDGLMYERRLFHALFATQD
QKEGMAAFLEKRPAVFTHR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttggcctacgaagtcatcgaggtccgcaccgaggcggacaaggtcggcgtcatcacgctg
aaccgccccaagcagctcaacgcgctcaacgaccagctcatggacgagctgggcgacgcg
ctggccgccttcgatgccgacgaacgcatcggctgcatcatcctcaccggcagtgaaaag
gccttcgcggcgggcgcggacatcggcgcgatggccaagtacggcttcgccgacgcctac
aagggcgactacatcacgcgcaactgggaacgcatccgctccatccgcaagccggtgatc
gcggccgtgagcggcttcgcgctgggcggcggctgcgagctggcgatgatgtgcgacttc
atcatcgccgccgacaacgcgaagttcggccagcccgagatcaagctcggcgtgattccg
ggcgcgggcggcacgcagcgcctgccgcgcgccgtgggcaagtccaaggccatggacatg
gccctcaccgcccgcatgatggatgcgcaggaggccgagcgtgccggcctggtgagccgc
gtcgtgccctacgacaagctcatggacgaagccctgggcgcggccctggtgatcgccggc
ttctcgcaggtggccgtcatggcggccaaggaaaccgtcaaccgcgccttcgagggggcg
ctctccgacggcctcatgtacgagcgccgcctgttccacgcgctgttcgccacgcaggac
cagaaggaaggcatggccgccttcctggaaaagcgcccggcggtgttcacgcaccgctga

DBGET integrated database retrieval system