KEGG   Acidovorax citrulli: Aave_0884Help
Entry
Aave_0884         CDS       T00451                                 

Definition
(GenBank) putative thiol:disulfide interchange protein (periplasmic)
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
aav  Acidovorax citrulli
Brite
Enzymes [BR:aav01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Aave_0884
Chaperones and folding catalysts [BR:aav03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Aave_0884
Secretion system [BR:aav02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Aave_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 DsbC_N DSBA Thioredoxin_4 Thioredoxin_7
Motif
Other DBs
NCBI-ProteinID: ABM31482
JGI: Aave0884
UniProt: A1TKJ4
Position
complement(960917..961657)
Genome map
AA seq 246 aa AA seqDB search
MKLIPALLAGAAALTLGLGAHAQESAIRKALGSRIPQLQNIDEVRATPMQGLYEVRIGTD
VFYTDAKGNYLIQGELIDTKARRNLTEDRINKLTAVDFASLPFQDAFTIVRGNGQRKLAV
FEDPNCGYCKRFEKDLQNVDNVTVYLFLYPILSPDSAEKSRNIWCSKDRAAAWQDHMVRD
KTTPAASCDTAAVQRNLAFGKKHKITGTPTLIFTDGSRVPGAIDAREVEKRLADAGSGAG
PAPATN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatccccgccctgctcgccggcgccgccgcgctcaccctcggcctcggcgcc
cacgcccaggaatcggcgatccgcaaggccctgggcagccgcatcccgcagctgcagaac
atcgacgaggtgcgcgccacgcccatgcagggcctgtacgaagtgcgcatcggcaccgat
gtgttctacaccgacgccaagggcaactacctcatccagggcgaactgatcgacaccaag
gcacgccgcaacctcaccgaggaccgcatcaacaagctcacggcggtggatttcgcctcc
ctgccgttccaggacgcgttcaccatcgtgcgcggcaacggccagcgcaagctcgccgtg
ttcgaggacccgaactgcggctactgcaagcgcttcgagaaggacctgcagaacgtggac
aacgtgacggtctatctcttcctctatcccatcctgagccccgattcggccgagaagtcg
cgcaacatctggtgctccaaggaccgcgcggcggcatggcaggaccacatggtgcgcgac
aagaccacgccggccgcgagctgcgacacggccgccgtgcagcgcaacctggccttcggc
aagaagcacaagatcaccggcacgcccacgctgatcttcaccgacggctcgcgcgttccc
ggcgccatcgacgcgcgcgaggtggaaaagcgcctcgccgacgcgggatcgggcgccggc
ccggcccccgccacgaactga

DBGET integrated database retrieval system