KEGG   Acidovorax citrulli: Aave_1046Help
Entry
Aave_1046         CDS       T00451                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aav  Acidovorax citrulli
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_1046
Enzymes [BR:aav01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Aave_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1151226..1152089
Genome map
AA seq 287 aa AA seqDB search
MTATAPAVPAASLPPFPDLPAVRLHGPRAGAATVAFQGAQVLSWTTADGVERLFLSPRSA
HDGHTAIRGGVPVCCPQFNQRGALPKHGFMRNLPWKLVSESSNGHVTGAVMALGDDEATR
ALWPHAFQALLAVELSEDALRLSLTLRNTGDAPWSFTGALHTYLRVADIARAQVDGLQGC
ARWDAVADRRGMQEGAVRFDGEYDSVFEAPGAPLRVDTGQGVLAATQGGWAENVVWNPGA
QRCAALPDMPGDGFRHMLCVEAACVHRPVEVAPGAEWTGWQRFEVLR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaccgctccggccgtgcccgcggcctccctcccgccgtttccggacctgccc
gccgtccggctgcacggcccccgggcaggcgccgccaccgtcgctttccaaggggcgcag
gtgctttcctggaccaccgcggacggcgtcgagcgcctttttctgagcccccggtcggcc
catgacggacacacggcgatccgcggcggggtgccggtttgctgcccccaattcaaccag
cggggggctttgcccaagcatggctttatgcgaaatttgccttggaaattggtatccgag
tcgtcaaacggtcacgtgacgggtgccgtgatggcgctcggggacgacgaggccacccgc
gcgctctggccccatgccttccaggccctgctggccgtggagctgtccgaagacgccctg
cgcctgtcgctcaccctgcgcaacaccggtgatgcgccctggtccttcaccggcgcgctg
catacctatctgcgggtggcggacatcgcccgggcgcaggtggacgggctgcagggctgc
gcccgctgggacgccgtcgccgaccggcgcggcatgcaggaaggcgcggtgcgcttcgac
ggtgaatacgacagcgtgttcgaggccccgggcgcgccgctgcgcgtggacacggggcag
ggcgtgctggccgccacccagggcggctgggccgagaatgtcgtctggaatcccggcgcc
cagcgctgcgcggcgctgccggacatgcccggggacggcttccgccacatgctgtgcgtg
gaggctgcctgcgtgcaccggcccgtcgaagtggcgccgggcgccgaatggaccggctgg
cagcggttcgaagtgctgcgctga

DBGET integrated database retrieval system