KEGG   Acidovorax citrulli: Aave_1046Help
Entry
Aave_1046         CDS       T00451                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aav  Acidovorax citrulli
Pathway
aav00010  Glycolysis / Gluconeogenesis
aav01100  Metabolic pathways
aav01110  Biosynthesis of secondary metabolites
aav01120  Microbial metabolism in diverse environments
aav01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aave_1046
Enzymes [BR:aav01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Aave_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABM31643
JGI: Aave1046
UniProt: A1TL05
Position
1151226..1152089
Genome map
AA seq 287 aa AA seqDB search
MTATAPAVPAASLPPFPDLPAVRLHGPRAGAATVAFQGAQVLSWTTADGVERLFLSPRSA
HDGHTAIRGGVPVCCPQFNQRGALPKHGFMRNLPWKLVSESSNGHVTGAVMALGDDEATR
ALWPHAFQALLAVELSEDALRLSLTLRNTGDAPWSFTGALHTYLRVADIARAQVDGLQGC
ARWDAVADRRGMQEGAVRFDGEYDSVFEAPGAPLRVDTGQGVLAATQGGWAENVVWNPGA
QRCAALPDMPGDGFRHMLCVEAACVHRPVEVAPGAEWTGWQRFEVLR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaccgctccggccgtgcccgcggcctccctcccgccgtttccggacctgccc
gccgtccggctgcacggcccccgggcaggcgccgccaccgtcgctttccaaggggcgcag
gtgctttcctggaccaccgcggacggcgtcgagcgcctttttctgagcccccggtcggcc
catgacggacacacggcgatccgcggcggggtgccggtttgctgcccccaattcaaccag
cggggggctttgcccaagcatggctttatgcgaaatttgccttggaaattggtatccgag
tcgtcaaacggtcacgtgacgggtgccgtgatggcgctcggggacgacgaggccacccgc
gcgctctggccccatgccttccaggccctgctggccgtggagctgtccgaagacgccctg
cgcctgtcgctcaccctgcgcaacaccggtgatgcgccctggtccttcaccggcgcgctg
catacctatctgcgggtggcggacatcgcccgggcgcaggtggacgggctgcagggctgc
gcccgctgggacgccgtcgccgaccggcgcggcatgcaggaaggcgcggtgcgcttcgac
ggtgaatacgacagcgtgttcgaggccccgggcgcgccgctgcgcgtggacacggggcag
ggcgtgctggccgccacccagggcggctgggccgagaatgtcgtctggaatcccggcgcc
cagcgctgcgcggcgctgccggacatgcccggggacggcttccgccacatgctgtgcgtg
gaggctgcctgcgtgcaccggcccgtcgaagtggcgccgggcgccgaatggaccggctgg
cagcggttcgaagtgctgcgctga

DBGET integrated database retrieval system