KEGG   Acidovorax citrulli: Aave_1200Help
Entry
Aave_1200         CDS       T00451                                 

Definition
holo-acyl-carrier-protein synthase (EC:2.7.8.7 3.2.1.52)
Orthology
K00997  
holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aav  Acidovorax citrulli
Pathway
Amino sugar and nucleotide sugar metabolism
Pantothenate and CoA biosynthesis
Biosynthesis of secondary metabolites
beta-Lactam resistance
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Aave_1200
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Aave_1200
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Aave_1200
Enzymes [BR:aav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.7  holo-[acyl-carrier-protein] synthase
     Aave_1200
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Aave_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1320230..1321861
Genome map
AA seq 543 aa AA seqDB search
MIYGIGTDICDVRRIRAGLERHGDRFAEKVLAAGELATWRERSARWPERGVRYLATRFSA
KEAFSKAIGMGMRMPMTWRDCEVAKLPSGQPVIVLHGALKAWFESQGLRCHLSVTDESDY
AASFCVVERGDPGEGARPDAVQPLRPEPPCRIPPFFLRTYSVSCMTADIEHAPLILDIAG
TALTPADRRRLAHPLTGGIILFARNWENRAQLLELTASIKAVRDDLLICVDHEGGRVQRF
RTDGFTHLPPMRALGALWMDDGREGPGTGAMRAMDAASAVGYVLASELRACGVDFSFAPV
LDLDWPSGGDGSAGSASASSVIGDRAFHRDPRVVAMLAKSVAHGMLKAGMAHCGKHFPGH
GFVAADSHTDIPVDRRHLGAILANDAAPYAWLSNTLAGVMPAHVIYPRVDRLPAGFSRRW
LQDILRQRLRFGGAVFSDDLSMEGARRIDGAVVDFATATLAALDAGCDLVLLCNQSLVGE
GREQGRALDDVLDALERARGEGRWRPSPDSEARRLALLPQTLPHPWDELMLEPDYLRALD
CLP
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgatctacggcatcggtaccgacatctgcgatgtccgccgcatccgggcgggcctggag
cgccatggggaccgtttcgccgaaaaggtgctcgcggccggcgaactcgcgacttggcgc
gaacgcagcgcgcgttggcccgagcgcggcgtgcgctacctggccacgcgcttttccgcc
aaggaggctttcagcaaggcgatcggcatgggcatgcgcatgccgatgacctggcgggac
tgcgaggtggccaagctgcccagcggccagcccgtcatcgtgctgcacggcgccctcaag
gcctggttcgagtcgcaggggctgcgctgccacctgagcgtcaccgacgagagcgactat
gcggcgagcttctgcgtggtggagcgcggggacccgggcgagggcgcccgcccggatgcc
gtgcagcccctccggcctgagccgccctgccgcatccctcctttctttttacgcacgtat
tccgtttcctgcatgactgccgacatcgaacacgcacccctcatcctcgacatcgccggc
acggcgctcactccggccgaccgcaggcgcctggcccatccgctcaccggaggcatcatc
ctcttcgcccggaactgggaaaaccgcgcgcagctgctggaactcacggcctcgatcaag
gccgtgcgggacgacctgctcatctgcgtggaccacgaggggggccgggtgcagcgcttc
cgcaccgacggtttcacccacctgccgccgatgcgggcactgggcgccctgtggatggac
gacggccgcgagggcccgggtaccggcgcgatgcgcgcgatggatgccgccagcgccgtc
ggctacgtgctggccagcgagttgcgcgcctgcggcgtggatttctcgttcgcaccggtg
ctggatctggactggccgtcgggcggggacgggtccgcaggcagcgcctcggcgagcagc
gtgatcggcgaccgggccttccaccgcgacccgcgcgtggtggcgatgctggccaaaagc
gtggcgcacggcatgctcaaggcgggcatggcgcattgcggcaagcatttccctgggcac
ggcttcgtcgcggccgactcgcataccgacatccccgtggatcggcgccatctgggcgcg
atcctggcgaatgacgccgcaccctatgcctggctgtccaacacgctggccggcgtgatg
cctgcgcatgtcatctatccgcgcgtggaccggcttccggcagggttctcgcgccggtgg
ctgcaggacatcctgcgccagcgcctgcggttcggcggagcggtgttcagcgacgatctc
agcatggagggcgcccgtcgcatcgatggcgccgtggtggacttcgcgaccgccacgctc
gcggccctggatgccggctgcgatctggtgctgctgtgcaaccagagcctggtgggcgag
gggcgcgagcagggcagggcgctcgacgatgtgctcgatgccctggagcgcgcacgcggc
gaagggcgctggcgccccagtccggacagcgaggcccgccggctcgccctgcttccacag
acgctgccccatccctgggacgagctcatgctggagccggattacctgagggcgctggat
tgcctgccctga

DBGET integrated database retrieval system