KEGG   Acidovorax citrulli: Aave_1214Help
Entry
Aave_1214         CDS       T00451                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aav  Acidovorax citrulli
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aave_1214
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aave_1214
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aave_1214
Enzymes [BR:aav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Aave_1214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1336459..1337316)
Genome map
AA seq 285 aa AA seqDB search
MSADMTTSASTAPLAAQGRIAATFADLQARGRKALIPYVTAGFPFADITPALMHGMVEAG
ADVIELGVPFSDPMADGPVIQKAGEKALSLGVGMAQVLGYVREFRQRNTKTPVVLMGYAN
PVERYDQRHGDNAFVRDAAEAGVDGVLIVDYPPEECEDFAARLRAHGMDLIFLLAPTSTE
QRMQQVARVASGYVYYVSLKGVTGSGALDTSAVEAMLPVIRRHVHIPVGVGFGIRDAATA
QAIGRVADAVVIGSRIIQLLEDQPHERVVPLAVDFLRGVRKALDT
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgacatgacgacttccgcgtccacggcaccgctggccgcccaggggcgcatc
gcggcgacgttcgccgacctgcaggcccgcggccgcaaggccctcattccctacgtgacc
gccggcttcccgttcgcggacatcacgcccgcgctgatgcacggcatggtggaggccggc
gccgatgtgatcgaactcggcgtgccgttctccgatcccatggccgacggcccggtgatc
cagaaggccggggagaaggccctctccctgggcgtgggcatggcccaggtgctcggctat
gtgcgcgagttccgccagcgcaacacgaagaccccggtggtgctcatgggctacgccaac
ccggtggaacgctacgaccagcgccacggagacaacgccttcgtgcgcgatgcggccgag
gccggcgtggacggggtactgatcgtggattaccctcccgaagagtgcgaggacttcgca
gcccggctgcgcgcgcatggcatggacctgatcttcctgctggcgcccaccagcacggag
cagcgcatgcagcaggtggcgcgcgtcgcgagcggctacgtgtactacgtttcgctcaag
ggcgtgaccggctcgggcgccctcgatacttcggccgtggaagccatgctgccggtgatc
cgccgccatgtgcacatccccgtcggcgtgggtttcggcatccgcgatgcggccaccgcg
caggccatcggccgtgtcgcggatgccgtggtgatcggcagccgcatcatccaactgctg
gaagaccagccccacgagcgggtcgtgcccctggccgtggacttcctgcggggggtgcgc
aaggcgctcgacacgtag

DBGET integrated database retrieval system