KEGG   Acidovorax citrulli: Aave_1215Help
Entry
Aave_1215         CDS       T00451                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aav  Acidovorax citrulli
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aav01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aav00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aav00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1337313..1338581)
Genome map
AA seq 422 aa AA seqDB search
MLSYQQPDASGHFGRYGGSFASETLTHALTELREAYARYQNDPEFLKEFHSELAHFVGRP
SPIYHAARMSREMGGAQIFLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGAGQH
GVATATICARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSRTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGTECLAQMPGMLAGQRIAAEHPDAVIA
CVGGGSNAMGIFHPYIPHEKTRLIGVEAAGEGLDSGKHSASLQRGSAGVLHGNRTFILQD
ENGQITETHSISAGLDYPGVGPEHAWLQEIGRAEYVGITDREALDAFHYLCRTEGIIPAL
ESSHAVAYAMQLARTLRTDQSILVNLSGRGDKDIGTVADLSGVDFYDRPSMRGHAVKGGP
AA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctttcctaccaacagcccgacgcttcgggccacttcggccgctatggcggcagtttc
gcgagcgagacgctcacgcatgccctcaccgagctgcgcgaggcctatgcccgctaccag
aacgacccggagttcctgaaggaattccacagcgaactcgcgcacttcgtgggccggcct
tcgccgatctaccacgccgcgcgcatgagccgcgagatgggcggcgcgcagatcttcctc
aagcgggaagatctcaaccacacgggcgcgcacaagatcaacaacgtgatcggccaggcc
atgctcgcccgccgcatgggcaagccccgcgtgatcgccgagaccggcgctggccagcac
ggcgtcgccacggccaccatctgcgcccgctacggcctggaatgcgtggtgtacatgggc
gcggaagacgtgaagcgccagagcccgaatgtctatcgcatgaagctgctgggcgccacc
gtggtgcccgtggagtcgggcagccgcacgctcaaggatgcgctcaacgaggccatgcgc
gactgggtcgcgaacgtggacaacaccttctacatcatcggcaccgtggcgggcccgcac
ccctaccccatgatggtgcgcgacttccagagcgtgatcggcaccgaatgccttgcccag
atgcccggcatgctggccgggcagcgcatcgccgccgagcacccggacgcggtgatcgcc
tgcgtgggcggcggcagcaatgccatgggcatcttccatccctacatcccgcacgagaag
acgcgcctcatcggcgtggaggcggccggcgaggggctggacagcggcaagcactcggca
tcgctgcagcgcggcagcgcgggcgtgctgcacggcaaccgcacgttcatcctgcaggac
gagaacggccagatcaccgagacgcacagcatcagcgccggcctcgactaccctggcgtc
gggcccgagcatgcctggctgcaggagatcggccgcgccgagtacgtgggcatcaccgac
agggaagcgctcgacgccttccactacctctgccgcaccgagggcatcatccccgcgctg
gagtccagccatgccgtggcctacgcgatgcagctcgccaggaccctgcgcaccgaccag
tccatcctcgtgaacctttccggccggggcgacaaggacatcggcacggtggcggatctc
tccggcgtggatttctacgaccgcccgtccatgcggggccatgccgtcaagggagggccc
gcggcatga

DBGET integrated database retrieval system