KEGG   Acidovorax citrulli: Aave_1215Help
Entry
Aave_1215         CDS       T00451                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aav  Acidovorax citrulli
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aav00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aave_1215
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aave_1215
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aave_1215
Enzymes [BR:aav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Aave_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1337313..1338581)
Genome map
AA seq 422 aa AA seqDB search
MLSYQQPDASGHFGRYGGSFASETLTHALTELREAYARYQNDPEFLKEFHSELAHFVGRP
SPIYHAARMSREMGGAQIFLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGAGQH
GVATATICARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSRTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGTECLAQMPGMLAGQRIAAEHPDAVIA
CVGGGSNAMGIFHPYIPHEKTRLIGVEAAGEGLDSGKHSASLQRGSAGVLHGNRTFILQD
ENGQITETHSISAGLDYPGVGPEHAWLQEIGRAEYVGITDREALDAFHYLCRTEGIIPAL
ESSHAVAYAMQLARTLRTDQSILVNLSGRGDKDIGTVADLSGVDFYDRPSMRGHAVKGGP
AA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctttcctaccaacagcccgacgcttcgggccacttcggccgctatggcggcagtttc
gcgagcgagacgctcacgcatgccctcaccgagctgcgcgaggcctatgcccgctaccag
aacgacccggagttcctgaaggaattccacagcgaactcgcgcacttcgtgggccggcct
tcgccgatctaccacgccgcgcgcatgagccgcgagatgggcggcgcgcagatcttcctc
aagcgggaagatctcaaccacacgggcgcgcacaagatcaacaacgtgatcggccaggcc
atgctcgcccgccgcatgggcaagccccgcgtgatcgccgagaccggcgctggccagcac
ggcgtcgccacggccaccatctgcgcccgctacggcctggaatgcgtggtgtacatgggc
gcggaagacgtgaagcgccagagcccgaatgtctatcgcatgaagctgctgggcgccacc
gtggtgcccgtggagtcgggcagccgcacgctcaaggatgcgctcaacgaggccatgcgc
gactgggtcgcgaacgtggacaacaccttctacatcatcggcaccgtggcgggcccgcac
ccctaccccatgatggtgcgcgacttccagagcgtgatcggcaccgaatgccttgcccag
atgcccggcatgctggccgggcagcgcatcgccgccgagcacccggacgcggtgatcgcc
tgcgtgggcggcggcagcaatgccatgggcatcttccatccctacatcccgcacgagaag
acgcgcctcatcggcgtggaggcggccggcgaggggctggacagcggcaagcactcggca
tcgctgcagcgcggcagcgcgggcgtgctgcacggcaaccgcacgttcatcctgcaggac
gagaacggccagatcaccgagacgcacagcatcagcgccggcctcgactaccctggcgtc
gggcccgagcatgcctggctgcaggagatcggccgcgccgagtacgtgggcatcaccgac
agggaagcgctcgacgccttccactacctctgccgcaccgagggcatcatccccgcgctg
gagtccagccatgccgtggcctacgcgatgcagctcgccaggaccctgcgcaccgaccag
tccatcctcgtgaacctttccggccggggcgacaaggacatcggcacggtggcggatctc
tccggcgtggatttctacgaccgcccgtccatgcggggccatgccgtcaagggagggccc
gcggcatga

DBGET integrated database retrieval system